KEGG   Faecalibacterium prausnitzii SL3/3: FPR_29580Help
Entry
FPR_29580         CDS       T02592                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:fpa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FPR_29580
   00630 Glyoxylate and dicarboxylate metabolism
    FPR_29580
   00640 Propanoate metabolism
    FPR_29580
   00650 Butanoate metabolism
    FPR_29580
  Lipid metabolism
   00071 Fatty acid degradation
    FPR_29580
   00072 Synthesis and degradation of ketone bodies
    FPR_29580
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FPR_29580
   00310 Lysine degradation
    FPR_29580
   00380 Tryptophan metabolism
    FPR_29580
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FPR_29580
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FPR_29580
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FPR_29580
Enzymes [BR:fpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FPR_29580
Exosome [BR:fpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FPR_29580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2988109..2989326
Genome map
AA seq 405 aa AA seqDB search
MKKIVIASACRTAIGKFGGTLANVPATELGSIVIKEALNRANVKPEQVDHVYMGCVIQAG
LGQNVARQAALKAGLPIETPAVTVNVVCGSGLNCVNMAAQMIEAGDADIVVAGGMENMDM
APFALQKARYGYRMGAPMGKSEIVDTMVNDALWDACGFNKHMGMTAENVCTNETYQKKYG
YSPITREMLDEFSYNSQLKADKAIKDGAFKDEIVPVVIKGKKGDTVFDTDEGPRLSAPEV
LAKLKPAFTKDGIVTAGNSSAINDGAAALVVMSEEKAKELGVKPLATWVAGALAGVEPEV
MGLGPIAATKKVMAKTGMTVADMDLVEANEAFAAQSIAVGEALGFDKDKLNVNGGAIALG
HPVGASGARILVTLLYAMKHRGAHKGLATLCIGGGMGCATIVEMD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcgttatcgcatctgcatgccgcaccgctatcggcaagttcggtggcact
ctggccaacgttcccgctactgagctgggctccatcgtcatcaaggaggctctgaaccgt
gcaaacgtcaagcccgagcaggtcgatcatgtttacatgggctgcgtcattcaggctggt
ctgggccagaacgtcgctcgtcaggctgccctgaaggctggcctgcccatcgagaccccc
gctgtcaccgtcaacgtggtctgcggctctggtctgaactgcgtgaacatggctgctcag
atgatcgaggcaggcgatgctgatatcgttgttgcaggcggcatggagaacatggacatg
gctcccttcgcactgcagaaggctcgctacggctaccgcatgggcgctcccatgggcaag
agcgagatcgtggataccatggtcaacgatgcactgtgggatgcctgcggcttcaacaag
cacatgggcatgaccgctgagaacgtctgcaccaacgagacctaccagaagaagtacggc
tacagccccatcacccgcgagatgctggacgagttctcatacaacagccagctgaaggct
gacaaggccatcaaggacggcgccttcaaggacgagatcgttcctgttgtcatcaagggc
aagaagggcgacaccgtgttcgataccgatgagggcccccgtctgagcgctcccgaggtt
ctggcaaagctgaagcccgccttcaccaaagacggcatcgtcaccgctggtaactcttcc
gccatcaacgacggcgctgctgctctggtcgtcatgagcgaggagaaggctaaggagctg
ggcgtgaagcctctggcaacctgggtcgccggtgctctggcaggcgttgagcccgaggtc
atgggtctgggccccatcgctgctaccaagaaggtcatggccaagaccggcatgaccgtt
gctgatatggatctggtcgaggccaacgaggcattcgcagcacagtccatcgctgtcggc
gaggctctgggcttcgataaggacaagctgaacgtcaacggcggcgcaatcgctttgggt
cacccggtcggcgcttccggcgctcgtatcctggtcaccctgctgtacgctatgaagcac
cgtggtgctcataagggtctggctaccctgtgcatcggcggcggcatgggctgcgctacc
atcgttgagatggactaa

DBGET integrated database retrieval system