KEGG   Fervidobacterium pennivorans: Ferpe_0075Help
Entry
Ferpe_0075        CDS       T01808                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ferpe_0075
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ferpe_0075
Enzymes [BR:fpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Ferpe_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82437..83708
Genome map
AA seq 423 aa AA seqDB search
MGSIIVERSQLTGEVEISGAKNSALPLLAAALLTEEEVVLHKVPVLSDVETMIDILRTTG
KKVLFEKDKNTVHISGPIQQTHVPYDLVRKMRASFNVLGPIAALMGEASTPLPGGCAIGV
RPVDFHIEGLKRLGFEVTYDHGEILAKRGTKQEEVTVYLPFPSVGATEHIMSTAAILPGV
TIIENAAMEPEIVDLQDLLNKMGAKISGAGTSRIVVEGVKQLHGCEHTVIPDRIEAGTYA
IAFLATRGEGVIKNVNPTHLDALWFVLERTGAVVKKGTDFVEVKSWNRWKGCDINVLPYP
GFPTDLQPQIIVYLALADGSSTVTENVFKTRFAHVGELVRMGADMRIKDNTVFINGVPKL
EGTTVMGTDLRATAALVIAGLAAEGTTEVTQVEHIFRGYENVIEKFEKIGAKIKYVPGGV
PEI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggggtcaataattgttgagagatcgcagctaacaggtgaagtcgagatttccggagca
aaaaattctgcgcttccattgttggctgctgcacttctaacagaggaagaggtagttcta
cacaaagtccccgttttatctgacgttgaaacaatgatagatattttgagaacgacaggc
aaaaaggtgttatttgaaaaagacaaaaacacagtccacatatctggacctatccagcag
acgcatgtaccgtacgatttagtaagaaagatgcgagcatcgtttaacgttcttggacca
atagcggcactcatgggagaagcgagcacaccacttccaggtggttgtgctataggtgtt
cgccctgtcgatttccacattgaaggcctcaaaaggcttggctttgaagttacttatgac
catggtgagatattggccaagcgtggaacaaaacaagaagaggtgacggtctatcttcca
tttccaagtgtaggcgctacagagcatataatgagtactgcagcgatactacctggtgtt
actattattgaaaacgctgccatggaaccggagatagtagaccttcaagatttactaaat
aaaatgggtgcaaaaatttcgggtgctggaacaagtaggatagtcgttgaaggtgtcaaa
caacttcacggttgcgaacacacggttatacctgacagaatcgaagcaggtacgtacgct
attgcattccttgcaacacgtggtgaaggggttattaagaatgtaaatccaacgcacctt
gatgcattatggtttgtgctcgaaagaacaggtgcagttgttaagaaagggacggacttt
gtcgaagtcaaatcctggaaccgatggaaaggttgtgatatcaatgtgctaccttatcca
ggattcccaacggatttacaaccacaaataattgtttacctcgcacttgcggatggttca
agcacggtcacagaaaatgtattcaaaacacgctttgcacacgttggtgagcttgttaga
atgggggcggatatgagaataaaggacaacacggttttcataaacggggttccaaagtta
gaaggaactacagtaatgggcacggatttaagggcgactgcggcactggtgatagcagga
cttgctgccgaaggaacaacggaagttactcaggttgagcacatatttagaggctatgag
aacgtcatcgaaaaatttgaaaaaatcggtgcaaaaatcaaatacgtgcccggaggtgtt
ccagaaatttga

DBGET integrated database retrieval system