KEGG   Fervidobacterium pennivorans: Ferpe_0075Help
Entry
Ferpe_0075        CDS       T01808                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fpe00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:fpe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82437..83708
Genome map
AA seq 423 aa AA seqDB search
MGSIIVERSQLTGEVEISGAKNSALPLLAAALLTEEEVVLHKVPVLSDVETMIDILRTTG
KKVLFEKDKNTVHISGPIQQTHVPYDLVRKMRASFNVLGPIAALMGEASTPLPGGCAIGV
RPVDFHIEGLKRLGFEVTYDHGEILAKRGTKQEEVTVYLPFPSVGATEHIMSTAAILPGV
TIIENAAMEPEIVDLQDLLNKMGAKISGAGTSRIVVEGVKQLHGCEHTVIPDRIEAGTYA
IAFLATRGEGVIKNVNPTHLDALWFVLERTGAVVKKGTDFVEVKSWNRWKGCDINVLPYP
GFPTDLQPQIIVYLALADGSSTVTENVFKTRFAHVGELVRMGADMRIKDNTVFINGVPKL
EGTTVMGTDLRATAALVIAGLAAEGTTEVTQVEHIFRGYENVIEKFEKIGAKIKYVPGGV
PEI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggggtcaataattgttgagagatcgcagctaacaggtgaagtcgagatttccggagca
aaaaattctgcgcttccattgttggctgctgcacttctaacagaggaagaggtagttcta
cacaaagtccccgttttatctgacgttgaaacaatgatagatattttgagaacgacaggc
aaaaaggtgttatttgaaaaagacaaaaacacagtccacatatctggacctatccagcag
acgcatgtaccgtacgatttagtaagaaagatgcgagcatcgtttaacgttcttggacca
atagcggcactcatgggagaagcgagcacaccacttccaggtggttgtgctataggtgtt
cgccctgtcgatttccacattgaaggcctcaaaaggcttggctttgaagttacttatgac
catggtgagatattggccaagcgtggaacaaaacaagaagaggtgacggtctatcttcca
tttccaagtgtaggcgctacagagcatataatgagtactgcagcgatactacctggtgtt
actattattgaaaacgctgccatggaaccggagatagtagaccttcaagatttactaaat
aaaatgggtgcaaaaatttcgggtgctggaacaagtaggatagtcgttgaaggtgtcaaa
caacttcacggttgcgaacacacggttatacctgacagaatcgaagcaggtacgtacgct
attgcattccttgcaacacgtggtgaaggggttattaagaatgtaaatccaacgcacctt
gatgcattatggtttgtgctcgaaagaacaggtgcagttgttaagaaagggacggacttt
gtcgaagtcaaatcctggaaccgatggaaaggttgtgatatcaatgtgctaccttatcca
ggattcccaacggatttacaaccacaaataattgtttacctcgcacttgcggatggttca
agcacggtcacagaaaatgtattcaaaacacgctttgcacacgttggtgagcttgttaga
atgggggcggatatgagaataaaggacaacacggttttcataaacggggttccaaagtta
gaaggaactacagtaatgggcacggatttaagggcgactgcggcactggtgatagcagga
cttgctgccgaaggaacaacggaagttactcaggttgagcacatatttagaggctatgag
aacgtcatcgaaaaatttgaaaaaatcggtgcaaaaatcaaatacgtgcccggaggtgtt
ccagaaatttga

DBGET integrated database retrieval system