KEGG   Fervidobacterium pennivorans: Ferpe_0152Help
Entry
Ferpe_0152        CDS       T01808                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ferpe_0152
Enzymes [BR:fpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ferpe_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(163089..164006)
Genome map
AA seq 305 aa AA seqDB search
MIAIVGSSNIDIVLTVEHFTNPGETQRITKLEYFPGGKGANQAVAIARLSEKPVYFLTAV
GDDQYGKILTENYERENIHGYRVVSGISTGMAFIEVCLSGENRIIIYPGANACLTQEMVL
DSKEELLKANILLVQNEIPFETTLYACAMFKEASKIVIFDPAPAQDIRPEIFRYVDFLTP
NEEELNALSKTFFDNFVSIEDSFEKFNKLGLKAMIVKLGDKGATYVDSNRLFNIPTIKVT
AVDTTAAGDVFNGALAVALSEGKDLAEAIRYANICAAISVTRKGAQPSIPKRIEVEEFLK
GIQPL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgattgctatcgttggaagctcaaacatagatatcgtgctcacagtggaacatttcaca
aatcccggagagactcagagaataactaaacttgagtattttcctggtggaaaaggagcc
aaccaagcagttgctattgcccgcctatctgagaaacccgtgtattttctcaccgccgta
ggtgatgatcaatacggaaaaatattgactgaaaactacgaacgcgagaatattcacgga
tacagagttgtcagtggtatctcgacaggtatggcttttatcgaagtttgcctctcggga
gagaatagaataataatctatccaggtgcgaatgcttgtttaactcaagaaatggtatta
gattcgaaagaggagctgctcaaagctaatatcttacttgtacagaacgagatacctttc
gaaacaacactctacgcttgtgctatgtttaaagaagcaagcaaaatagttatttttgac
cccgcaccagctcaagatatcaggcccgagatttttagatatgtcgactttcttacacca
aatgaggaagaacttaacgcacttagcaaaacgttttttgacaattttgtttcaatagaa
gattctttcgaaaaattcaacaaattaggtttgaaggctatgatagttaaactgggggat
aagggagcaacgtatgtagattccaacagactcttcaacattccaacaataaaagtcaca
gctgtcgacacaacagcagctggcgatgtctttaatggagctcttgcagtagccttgagt
gaaggtaaagacttagccgaggctataagatacgccaatatatgtgcggctatctctgtt
acaagaaaaggtgctcagccatcaattcccaaaaggattgaagttgaagagtttttaaaa
ggtattcagcctttgtaa

DBGET integrated database retrieval system