KEGG   Fervidobacterium pennivorans: Ferpe_0208Help
Entry
Ferpe_0208        CDS       T01808                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ferpe_0208
Enzymes [BR:fpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ferpe_0208
Exosome [BR:fpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ferpe_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(219907..221352)
Genome map
AA seq 481 aa AA seqDB search
MFVGLDQGTTSTRAILFDDDFSVVHEARREFRQIYPKEGWVEHNPEDIWQTVVEVLEECQ
RVANSRGKKIDVIGITNQRETVVAWDSETKEVLHNAIVWQCRRTAERSSYLRKEYGRVIK
EKTGLVVDPYFSATKMEWLIQNVPEVQKAYNKGTLRFGTIDSFLAWKLTGRHVTDYSNAS
RTMIFNINTLDWDDELLELFGIKREFLPEVVDTAQFIGYTDDGIPVASLVGDQQAALFGQ
TAFQKGDVKCTLGTGSFILMNTGNEKIYSEHNLLSTVGWKIKDELVYALEGSVFITGTLV
NYLIKNLGFAKDSLELTELALQVGNNGGIYFVPALTGLGAPYWDPYARGLIIGLTPGTDK
RHIIYAAFEGIAFSVGQLVMLMEKESNIKINALKVDGGVSKNNLIMQILADVVNTVVERP
VNRETTALGAASLAAIALGLVTKEKLQEIRKIDRIFTPKQSREEEFNKWKQAVNRALNWE
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttggtttggaccaaggaacaacaagcacaagggcaattttatttgatgatgat
ttttccgtcgttcacgaggcacgtagagaatttcgtcagatatacccgaaagaagggtgg
gtcgaacacaaccctgaagacatttggcaaaccgttgttgaggttctcgaagaatgccaa
cgagttgcaaattcaagggggaagaaaatagatgttatcggtataacgaatcaaagagaa
acggttgttgcctgggattctgaaactaaagaagtgctacacaacgccatagtttggcag
tgtcgtagaacggcggagagatcaagttatctgagaaaagagtacggacgtgtgataaaa
gagaaaacaggattagttgtagacccgtacttttcagcaactaaaatggaatggcttatt
caaaatgtgccagaagtacaaaaagcttataacaaagggacgttgaggttcggaacgata
gatagtttccttgcttggaaattgacaggcaggcacgtgacagattattcaaacgcatca
agaactatgatatttaatataaacactctcgattgggacgacgaacttttggaattgttc
ggcatcaagagggaattcttacctgaagttgttgatacagcacagttcataggttacaca
gacgacggtattcctgtggcatctttagttggtgaccaacaggcggcactctttggtcaa
acggcgttccaaaaaggagatgtaaaatgcacgctcgggactggcagctttattttaatg
aacacaggaaatgaaaaaatctattcagaacataacttgttaagcaccgttggatggaag
attaaggatgagcttgtctacgcactcgaaggtagtgtgttcataacgggcacgttggta
aattatctcatcaaaaaccttggtttcgcaaaagatagcttggaattaactgagctagca
ctccaggttggcaacaatggaggaatctacttcgttccagcactcacaggacttggcgct
ccttactgggacccatacgcaaggggattgataatcgggctcacccccggaactgacaaa
agacatatcatctacgctgcattcgagggtatcgcattttccgtcggacaattagtcatg
ttgatggaaaaagaaagtaatataaagattaacgccctaaaagtagacggcggcgtatcg
aaaaataaccttatcatgcaaatccttgccgatgtggtgaatacagtggttgaaagacca
gttaacagagaaacaacagcccttggggcagcaagcttggccgctatcgctttaggcttg
gtcactaaggaaaagcttcaggaaattaggaagatagataggatatttactccaaaacaa
tctcgtgaggaggaattcaacaagtggaaacaagcagtcaaccgcgcattgaactgggaa
tcttaa

DBGET integrated database retrieval system