KEGG   Fervidobacterium pennivorans: Ferpe_0271Help
Entry
Ferpe_0271        CDS       T01808                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fpe  Fervidobacterium pennivorans
Brite
Enzymes [BR:fpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ferpe_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(285839..286435)
Genome map
AA seq 198 aa AA seqDB search
MYEHLEYYGVSKRVIDAMNKVDRKLFVPAEYQDSAYIDTPLPIGYGQTISAPHMVGLMCE
YLDLQEGDKVLEIGTGSGYNAAVMSQLVGPSGEIYTVEVVEPLYERAKKVIEQLGIENIK
MFLSDGKLGLPQFAPYDKIVATCYAKEIPPALIEQLREGGILLIPVGNEYIQVLKRIKKY
GQKITEESLGHVRFVPMV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgagcatcttgagtattacggcgtatcaaagagagttatagatgctatgaataaa
gtagacagaaaactctttgttcctgcagagtatcaagatagtgcatacattgacacacct
cttccaataggttacggtcaaacgatatcagcaccacatatggttggattaatgtgcgaa
tatttggatttacaagaaggagacaaagtactcgaaattggaactggaagtgggtacaac
gctgctgtaatgtcacaactcgttggaccttcgggggaaatttacactgttgaagtcgtc
gaacctttgtacgaaagagcgaagaaagttattgaacaattaggaatagaaaacatcaaa
atgtttctcagtgatgggaagcttggattaccacagtttgctccttatgacaaaatcgtt
gccacgtgttacgcaaaagaaatcccacccgcactgattgaacaacttcgcgaaggtggg
attttattaattcctgtcgggaacgaatatatccaggttctgaagagaataaaaaaatac
ggtcaaaaaattaccgaagaatcattaggacatgttaggtttgtaccgatggtgtaa

DBGET integrated database retrieval system