KEGG   Fervidobacterium pennivorans: Ferpe_0305Help
Entry
Ferpe_0305        CDS       T01808                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferpe_0305
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ferpe_0305
   00640 Propanoate metabolism
    Ferpe_0305
   00660 C5-Branched dibasic acid metabolism
    Ferpe_0305
Enzymes [BR:fpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ferpe_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324300..325367
Genome map
AA seq 355 aa AA seqDB search
MKIHEYLAKDILRAEKVRVPRSYLVTSEELAEEKSLRKCLERLGFPQVLKAQVLVGGRMK
AGGIVVAENLEKSLEGIRKILGMKIKGEEPYGVLVEEYIPHDTERYISLSIDRNVRDVVF
VYSEVGGVDIEEFASKYPDKVLRTSNIRELPKDLQEFAKQLYDIFVRYDLTLLEINPFVF
KDGDFYALDAVFHVDDSALYRQLWAYEDTEETNSFVPFENGEIGVIGCGAGIVMATIDIL
VEHGYKPANFCDLGGGATMESVYEALKKVMSLCSKAVLNIFGGITDCLEIAKGVVNFKEE
DPDFEIYIRLSGNNEFLAKELLKKHGIYAVDDMKDLIERLQEDEKVQKRGVNDVF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtatttggcaaaggatatcctgagggcggaaaaagtaagagtacca
agaagctatttggtaacatccgaagaactagcagaagaaaagtctttaaggaagtgcttg
gaaaggctcggttttccgcaggtccttaaagctcaagtattagttggtgggaggatgaaa
gccggcggaattgtggtcgccgaaaatttggaaaaaagtctcgaaggtattaggaagatt
ttggggatgaagataaaaggagaggaaccctacggagtattagttgaagaatacattccg
catgacactgagagatacatttcactttcaatcgacagaaatgtcagagacgttgtgttt
gtgtattctgaggttggtggtgtggacatagaagaatttgcatcgaaatatccagacaaa
gtgctgcgtacaagcaacatacgagaacttcccaaagaccttcaggaatttgcgaagcag
ttgtacgatatattcgtaagatacgatttaacgttgctcgagattaatccttttgttttt
aaagacggagatttttacgcgttagatgccgtgtttcatgtggatgacagtgcgctgtat
agacaattgtgggcatatgaggatactgaagaaacaaattctttcgtgccgtttgaaaat
ggagaaattggcgtgattggctgtggtgcagggattgttatggcaacgatagatatactt
gttgagcatggttacaaaccagctaatttttgtgatttgggcggtggtgcaacaatggaa
agtgtttacgaggcgttgaaaaaagtcatgtctttgtgtagtaaagcagttttgaatatc
tttgggggcatcaccgattgtttggaaatagccaaaggcgttgtgaattttaaagaagaa
gacccagatttcgaaatttatattaggttgtctggaaacaacgaatttctggcaaaagaa
ttattaaaaaagcacggaatttatgctgttgacgatatgaaagatttaattgaaagactt
caagaagatgagaaggttcaaaagaggggtgttaacgatgttttttaa

DBGET integrated database retrieval system