KEGG   Fervidobacterium pennivorans: Ferpe_0305Help
Entry
Ferpe_0305        CDS       T01808                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferpe_0305
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ferpe_0305
   00640 Propanoate metabolism
    Ferpe_0305
   00660 C5-Branched dibasic acid metabolism
    Ferpe_0305
Enzymes [BR:fpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ferpe_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324300..325367
Genome map
AA seq 355 aa AA seqDB search
MKIHEYLAKDILRAEKVRVPRSYLVTSEELAEEKSLRKCLERLGFPQVLKAQVLVGGRMK
AGGIVVAENLEKSLEGIRKILGMKIKGEEPYGVLVEEYIPHDTERYISLSIDRNVRDVVF
VYSEVGGVDIEEFASKYPDKVLRTSNIRELPKDLQEFAKQLYDIFVRYDLTLLEINPFVF
KDGDFYALDAVFHVDDSALYRQLWAYEDTEETNSFVPFENGEIGVIGCGAGIVMATIDIL
VEHGYKPANFCDLGGGATMESVYEALKKVMSLCSKAVLNIFGGITDCLEIAKGVVNFKEE
DPDFEIYIRLSGNNEFLAKELLKKHGIYAVDDMKDLIERLQEDEKVQKRGVNDVF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtatttggcaaaggatatcctgagggcggaaaaagtaagagtacca
agaagctatttggtaacatccgaagaactagcagaagaaaagtctttaaggaagtgcttg
gaaaggctcggttttccgcaggtccttaaagctcaagtattagttggtgggaggatgaaa
gccggcggaattgtggtcgccgaaaatttggaaaaaagtctcgaaggtattaggaagatt
ttggggatgaagataaaaggagaggaaccctacggagtattagttgaagaatacattccg
catgacactgagagatacatttcactttcaatcgacagaaatgtcagagacgttgtgttt
gtgtattctgaggttggtggtgtggacatagaagaatttgcatcgaaatatccagacaaa
gtgctgcgtacaagcaacatacgagaacttcccaaagaccttcaggaatttgcgaagcag
ttgtacgatatattcgtaagatacgatttaacgttgctcgagattaatccttttgttttt
aaagacggagatttttacgcgttagatgccgtgtttcatgtggatgacagtgcgctgtat
agacaattgtgggcatatgaggatactgaagaaacaaattctttcgtgccgtttgaaaat
ggagaaattggcgtgattggctgtggtgcagggattgttatggcaacgatagatatactt
gttgagcatggttacaaaccagctaatttttgtgatttgggcggtggtgcaacaatggaa
agtgtttacgaggcgttgaaaaaagtcatgtctttgtgtagtaaagcagttttgaatatc
tttgggggcatcaccgattgtttggaaatagccaaaggcgttgtgaattttaaagaagaa
gacccagatttcgaaatttatattaggttgtctggaaacaacgaatttctggcaaaagaa
ttattaaaaaagcacggaatttatgctgttgacgatatgaaagatttaattgaaagactt
caagaagatgagaaggttcaaaagaggggtgttaacgatgttttttaa

DBGET integrated database retrieval system