KEGG   Fervidobacterium pennivorans: Ferpe_0326Help
Entry
Ferpe_0326        CDS       T01808                                 

Definition
transcriptional regulator/sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferpe_0326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferpe_0326
   00052 Galactose metabolism
    Ferpe_0326
   00500 Starch and sucrose metabolism
    Ferpe_0326
   00520 Amino sugar and nucleotide sugar metabolism
    Ferpe_0326
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ferpe_0326
   00524 Butirosin and neomycin biosynthesis
    Ferpe_0326
Enzymes [BR:fpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ferpe_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344872..345813
Genome map
AA seq 313 aa AA seqDB search
MYIVGIDLGGTFFKVGLVDAKDGKIVRKIERETKVYEGRIKVVERMAQAVLEITEGFEYT
GIGVGSPGSIDHDKGIVRFSPNFPDWVDFELGGELSSLLNKPVYVENDANAFVLGEKWFG
AGKGHEHIVALTLGTGVGGGVISHGVLITGKDGIGTELGHVIVEPNGPLCGCGNYGCLEA
LASATAIKRMALEGQRKFPESEIFKAEEVSAKVVFDAAKNGDLLAQTIVNRVVNALAIGV
TNFIHIFNPSIVVIGGGVSRAGDILFKPLREKVERLVMPSFKGTYEIVQSPLVEDAGILG
AASIVLQRSMNQQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgtacatagtaggtatagatttaggtggaacctttttcaaagtaggtctggttgatgca
aaggacggaaagattgtaagaaagattgaaagagaaacgaaggtgtatgaaggtagaatt
aaagtggttgagcgtatggcacaagccgtcttggaaataaccgaaggtttcgaatacact
ggtattggagtaggttcaccagggtctatagaccatgataagggaattgtgcgtttctca
ccaaatttcccggactgggtggattttgaacttggtggtgagctctcttctttgcttaac
aagcctgtctacgttgagaacgatgcgaatgcatttgtgcttggtgaaaaatggtttggc
gcaggcaaagggcacgagcatatagttgcgctaacacttgggacaggtgttggtggaggc
gttatttcccacggcgttcttataacaggaaaagatgggataggaactgaattgggacat
gttatagtagaaccaaatggaccgttgtgtgggtgtggaaattatggttgtcttgaagcg
ctagcttcagcaacagcaataaaacgaatggctttggaaggacaaagaaaatttccagaa
tccgaaatattcaaagccgaagaagtcagtgcaaaagttgttttcgacgctgcaaaaaac
ggtgatttacttgctcagacgatagtaaatagggttgttaatgcgttagccataggtgtg
actaatttcatccacatatttaatccgagcatagttgtcattggtggtggtgtttcccgt
gctggtgatattctcttcaagccgctgagagaaaaggttgagcgtcttgttatgccttct
ttcaaaggtacgtatgagattgtccaaagcccattagttgaagatgcaggcatacttgga
gcagcttctatcgtattgcaaagaagcatgaaccaacaataa

DBGET integrated database retrieval system