KEGG   Fervidobacterium pennivorans: Ferpe_0453Help
Entry
Ferpe_0453        CDS       T01808                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ferpe_0453
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ferpe_0453
Enzymes [BR:fpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Ferpe_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(481586..483073)
Genome map
AA seq 495 aa AA seqDB search
MSRAKKTLVKFTLYIQILFLVCIATLSSSNTLTTAYNTTKEVKKVENLKVRVWLTTVDQK
HLLKQVDIKEPLSTSYQEEYKIVVNTSKKYQQMDGFGASFTDASAYLVYNKLSPEKRREV
MEKLFDREKGIGISFLRQPMGATDYTTKLYSYDDLPPGVAEDPELKYFSIDHDKKYIIPL
LKEAMEINPELKIMASPWSPPGWMKTTGSMIGGSLRRSYYGVYAQYFVKFIKAYEAEGIP
IYAITVQNEPLYVPKEYPGMKMDWVEQADFIGEYLGPAFESAGIKTKILCYDHNWDNTTY
AAYVLSHEKASKYVAGSAWHFYGGKHEAMSKIKEMFPDKEIWFTEGSGGDWVPAFFNAYM
DQMMHVIRIPRNWAKTVVWWNIALDERRGPTILSKSTCRGLVEINQKTGEVKYNVDYYTL
GHISKFVLPGAYRIDSYTYQDKLESVAFLNPNGSRVLIVSNRTNTAKKVQVVEDGLEVFS
YILPAYASATFVWQE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagcgaaaaaaacgttagttaaattcacactttacatacagattttgttctta
gtatgcatagcaactttgagctcttcaaacacgctaacaactgcctacaacactactaag
gaggttaaaaaggtggagaatttaaaggttcgtgtttggctaacaacagtggatcaaaag
catttgcttaaacaagtggatataaaagaaccactttcaaccagctatcaggaggaatac
aaaatagttgtcaacactagcaaaaaataccaacaaatggatggttttggtgcttctttt
actgatgcttctgcttatcttgtatataacaaactatccccggaaaaaagaagagaggtc
atggagaaattattcgatagggagaaaggcattggtatctcttttctaaggcaaccaatg
ggggctaccgactatacaaccaaattgtatagttacgatgacttacccccaggtgttgct
gaggacccggagttgaagtatttttcaattgaccacgacaaaaaatatatcatcccgctt
ctcaaagaagcgatggaaataaaccctgagctaaaaattatggcatctccatggagtcct
cccggttggatgaaaacaacaggaagtatgataggtggttcgttaagaaggtcgtattac
ggtgtttacgctcagtactttgtgaagttcataaaggcttacgaagctgagggaatacca
atttacgctatcactgttcaaaacgagccattgtacgttccaaaagagtaccctggtatg
aagatggactgggtcgaacaggcagattttattggcgaataccttggaccggcttttgag
agtgcaggtatcaagacgaaaatcttgtgctacgaccataactgggacaacacaacttat
gccgcctacgttttatctcacgagaaggcttcaaaatacgtagcaggttcagcatggcat
ttctacggtggaaaacacgaggcgatgagcaagataaaagagatgttccccgataaggaa
atttggttcaccgaaggttcaggcggagattgggtgccagcatttttcaatgcatatatg
gaccaaatgatgcatgtaataagaattccaaggaactgggcaaagaccgttgtgtggtgg
aatatagctctcgatgaaagaagaggaccaacaatcctttcaaagagcacatgcagggga
ttagtagaaattaatcaaaaaacaggtgaagtcaaatacaacgtagattattacacactt
gggcacataagtaaatttgtgttaccaggagcatacagaatagattcttacacatatcaa
gacaaactcgaatctgttgcgtttttgaatccaaatggttcgagagtcctcattgtgtcc
aacagaacaaatacagctaagaaagttcaagttgttgaagacggtttggaagtcttttca
tacattttaccagcatacgcatccgctacttttgtttggcaagaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system