KEGG   Fervidobacterium pennivorans: Ferpe_0466Help
Entry
Ferpe_0466        CDS       T01808                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ferpe_0466
Enzymes [BR:fpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Ferpe_0466
Amino acid related enzymes [BR:fpe01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Ferpe_0466
Transfer RNA biogenesis [BR:fpe03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Ferpe_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
496306..497724
Genome map
AA seq 472 aa AA seqDB search
MSNNGQVRVRFAPSPTGYLHVGGARTALFNYLFARKTNGKFILRIEDTDLERSEKVFEEQ
LINALRWLGLDWDEGPDIGGPYGPYRQSERTELYHYYAQELIKQGKAYEVYAYPEEIEQL
REKLLAEGKAPHYTREMLEPYNTAERKREYEEKGLRPAIYFSMPRKDYVINDVVKGEVVF
KAGSVGDFALLRSNGMPTYNYACVIDDGLMKITHVLRGDDHLSNTVKQVALYEALGWPVP
VFGHVSMILGPDGSKLSKRHGATSVEEFKARGYLPEALVNFLALLGWSHPEGKEILTKEE
LISSFSLERLVKNPAIFNPDKLRWMNSEHIRMKDTKELVKLAKMFINRDVDEAYLEKVIV
AVKDRIEELSQLPELTDFFFERPNVSVEKTPEAVETYKALLEELQKVEVWNKENIYASFK
TAMKNAKLKGKDFYMTLRLILTGKNEGPELIDILEILGKEEVIARIQNYLNA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataacggtcaagttagagtaagatttgccccaagtccaacaggttatctgcat
gttggtggtgcaagaacagctttatttaactatctctttgcaaggaaaacaaacggaaaa
ttcattttaagaattgaggacacagaccttgaaaggtccgaaaaagttttcgaagaacaa
ctcatcaatgctttaaggtggcttgggttagattgggacgaaggaccagatattggtggt
ccgtacggtccgtacaggcagagcgaacggacagagctataccattactatgcacaagaa
ttgataaagcaagggaaagcttacgaggtttacgcctacccggaggaaattgaacaactt
cgtgagaaactacttgctgaaggcaaggcaccgcattacacgcgtgagatgcttgaacca
tacaatactgcagaaagaaaaagagagtacgaagaaaaagggttgagacctgcgatttac
ttctctatgcctcggaaggattatgtaatcaatgatgttgtaaaaggtgaggttgtattc
aaagctggcagtgttggtgacttcgcacttttgagaagtaacggcatgcctacgtataac
tacgcttgtgttattgatgatggtctcatgaaaataacccatgtgctaagaggggacgac
cacctttccaacactgtaaaacaagttgcgctgtatgaagcacttggttggcctgttcct
gtgtttggtcatgtgtcgatgattcttggacctgacggaagtaaacttagcaagcgccat
ggtgctacttcagtcgaagaattcaaagcaagaggatacttaccagaagctttggtcaat
ttcctagcacttcttggttggtcgcatccagaggggaaggaaatccttacaaaagaggaa
ctcataagcagtttctccttggaacgattggttaaaaacccagctattttcaatcctgat
aaattgagatggatgaactccgagcatatcaggatgaaggataccaaagaattagtaaaa
cttgcgaaaatgttcatcaacagagacgttgacgaggcttatttagaaaaagttattgta
gctgtaaaagacagaatcgaagaactctcccaactgccagagttaacagatttcttcttc
gaaagaccgaatgtttccgtagaaaaaaccccagaagctgttgaaacgtataaagcccta
cttgaagagttacaaaaggtagaagtttggaataaggaaaacatatatgcttcgtttaaa
acagcgatgaaaaatgcaaaactaaaaggtaaagacttttacatgacactcaggcttatt
ttaacaggtaagaacgagggaccagagttgatagatattcttgaaatacttgggaaggaa
gaagtcatagcacgtattcaaaattatttaaacgcgtaa

DBGET integrated database retrieval system