KEGG   Fervidobacterium pennivorans: Ferpe_0509Help
Entry
Ferpe_0509        CDS       T01808                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ferpe_0509
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ferpe_0509
Enzymes [BR:fpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ferpe_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544765..546264
Genome map
AA seq 499 aa AA seqDB search
MKLRHLLEAIQKFVVFDNIPEELKDKDVTGVFNNSRKVIPGSLFICRKGTKFDSHTIVDT
LYKESGVIAFVTEREINNNLPYVQVYDSRLAEAYLAAEFYEHPYKKLITFGVTGTNGKTT
CAHLFHHLMQQLGLTGSLSGTVMNDIMGDKFYIHNTTPDALTIMENMAKTVKSGGSYYSM
EVSSHSLDQARVETIRFDIAGLTNITRDHLDYHPTFEHYVNSKLHLFDLLKKDGIAVVHE
DYAPLVSSKKLPKLVTFGTSESAIYRISDISTTWNGTTFTLTSPYGTKKVYTQMIGDYNA
FNVTLVIAGLFELGYEPDEIISYVSTFRGVDGRFEPIPEARKLGIEVIIDFAHSPDALEK
VILAARRLTKGRIIVVYGAGGQADRGKRPMMAEVVTKLADIAILTTDDPRGEDPEEIIKE
VEKGVQPNSLSLTVLDRREAIDTAITLATKGDVVLITGRGHEPYQIFTETLKIPFKDRDV
ALDIILSKINKNHSRDVDK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattaagacatcttttggaagccattcagaagtttgtcgtttttgacaacatacca
gaagaattaaaagacaaagatgtaactggtgttttcaacaattcaagaaaggttattcca
ggttctctgttcatctgcaggaaaggtacaaagtttgattcacataccattgttgacaca
ctttacaaagaaagtggagtaatcgcctttgtcacagagagagaaatcaataacaacctt
ccttacgtccaagtttatgatagtagacttgcggaagcttacctcgcggctgagttttac
gaacatccttacaagaagctaataacttttggagtaactggcacaaatggaaaaactaca
tgtgcgcatttatttcaccatttaatgcagcaactgggactcacaggaagtttgtccgga
acagtcatgaacgacattatgggtgacaagttctatatacataacaccactcctgatgcg
ctcacaataatggaaaacatggcaaaaacggtaaagagtggtggaagctattattcaatg
gaagtttcctctcattcgttagaccaagcacgagtagaaaccatcagatttgatatagca
ggtcttacaaacataaccagagaccatctggattatcacccgacttttgaacattacgtg
aattcaaagctccacttgtttgatttgcttaaaaaagatggaatagcagttgttcatgaa
gattatgcaccgcttgtgtcaagcaaaaagctgccgaagcttgtcacatttggaacaagt
gaaagtgcaatttataggatttcagatatatcaactacttggaatgggacaacctttaca
ctcacatcaccttacggtacaaagaaagtctatacacagatgataggtgattacaatgct
ttcaatgttacgctggtcattgccgggttattcgagcttggatacgaacccgacgaaatc
atcagttatgtaagcacgtttagaggtgttgacggaaggtttgaaccaattccagaagca
agaaaacttggaattgaagtaataatagattttgcacactcacctgacgccttagaaaaa
gttatacttgccgcgagaagactgacaaaaggaagaattatagttgtctatggagctggt
ggacaagctgatagaggcaaaagaccgatgatggcagaagtggtaacgaaactcgcggat
atagcgatacttacaacagatgaccctcgtggagaagacccagaggagattataaaagaa
gttgaaaaaggtgtccaacctaattccctttcactcaccgtccttgatagacgcgaggct
atagatacagcaataacactcgcaacaaaaggagatgttgtgcttattaccggaagaggc
catgaaccataccagatattcacggaaacattaaagatacctttcaaagatagagatgtt
gctttggacataattctctcaaagattaacaaaaatcactcaagagatgtggataaataa

DBGET integrated database retrieval system