KEGG   Fervidobacterium pennivorans: Ferpe_0526Help
Entry
Ferpe_0526        CDS       T01808                                 

Definition
phosphosulfolactate phosphohydrolase-like enzyme
Orthology
K05979  
2-phosphosulfolactate phosphatase [EC:3.1.3.71]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:fpe00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
560799..561575
Genome map
AA seq 258 aa AA seqDB search
MIYTILSSREAQEWITEQRKLCVKQFNVSVVIDVLRATSTVITALSNGARSVIPVSNIEE
ALELKHRHPEYIIAGERGGQRIEGFQLGNSPTEYAEAVVRDKTIVLTTSNGTNAIIHASN
LAERVLIASFLNLTTVVHELAGYDSSTNIAIVCAGNNGEISYEDTQVAGAIISKLTKNRA
HYLSDSSKIAMKLWHALKKPNFSGEHAKKLSQLGFDKDLEFCQKVDYIPILAELRDGKII
KVEYNRKFKRGEKDVRAG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgatatatacaattctaagttccagagaagctcaagaatggataactgagcagcgtaag
ttgtgtgtcaaacaattcaacgtttccgttgttattgatgtgctgcgcgcaacatctact
gtaattacagcactgtcaaatggtgcaagaagtgttataccggtttcaaacattgaagaa
gctctggagttgaaacatcggcatccagaatatataattgctggcgaacgcggtggacaa
agaatagaaggctttcaacttggaaactcacctacagagtacgctgaggcagttgttagg
gataaaaccattgttcttaccacaagtaatggaacaaacgctataatccatgcctcgaat
ttggctgagagagttttgatagcatcttttctaaatttaactactgttgtgcacgaatta
gccggttatgattcttcaacaaacattgctatcgtttgcgcaggcaacaacggtgagatt
tcttacgaagatacacaagttgcaggagcgattatctcaaaacttaccaagaaccgtgct
cattatttatctgacagttctaaaatagcaatgaaactatggcatgctcttaaaaaaccg
aatttctcaggtgaacacgcaaaaaaactttctcagttaggttttgacaaagatttagaa
ttctgccaaaaggtggattacataccgattttagccgaactaagggatggtaaaataatt
aaggtggaatataacagaaaattcaaacgaggtgaaaaagatgttagagctggttga

DBGET integrated database retrieval system