KEGG   Fervidobacterium pennivorans: Ferpe_0843Help
Entry
Ferpe_0843        CDS       T01808                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ferpe_0843
Enzymes [BR:fpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Ferpe_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(897222..897899)
Genome map
AA seq 225 aa AA seqDB search
MAKKTKKSVEKFSFNYDIAESIVNYARKVSEEGLTKGTWGNISVRDGGYIYITPSGFPYD
KLTPKHIIVVDNEGRKVYGELTPSSELPLHIEIYEKRADVHAIIHTHPVYSTIVSVTLKE
IPPIVEDAVMILGERLFVSEYALPGTEELARNAIKALGNNHCVFLRNHGLVTVGENLQEA
LIATLVAEKTAQIYIEALRVGKVSILPDEHAKLLREKYLKSYRQK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaaacaaagaaaagtgtggaaaaattttccttcaattacgatatcgccgaa
tcgatagtcaattatgcccgtaaggtttctgaagaagggcttacgaaaggtacttgggga
aacattagtgtccgagatggtggatacatttacatcacaccatctgggtttccatatgat
aagttaacaccaaagcatataatagttgtagacaacgaggggaggaaagtctacggtgag
ttaacaccctcttcagaactacctttgcatattgagatttacgaaaagcgagcagatgtt
catgcaataatacacacacatcctgtttattctacaatagtctcggtgactttaaaagag
attcccccgattgttgaggatgctgtaatgattcttggagaacgtctttttgtttcagaa
tacgcacttccagggaccgaagaactcgcacggaacgccatcaaagctcttggaaataac
cattgtgtatttttaagaaaccacggtcttgtgaccgtgggtgaaaatctccaagaagct
ttaattgcaacactcgtcgcagaaaaaactgcacaaatttacatagaagcactcagagtt
ggaaaggtttctattcttccagatgagcatgcaaagttgttaagagaaaaatatctcaaa
tcatacaggcaaaaataa

DBGET integrated database retrieval system