KEGG   Fervidobacterium pennivorans: Ferpe_1187Help
Entry
Ferpe_1187        CDS       T01808                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fpe  Fervidobacterium pennivorans
Brite
Enzymes [BR:fpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Ferpe_1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1244159..1244920)
Genome map
AA seq 253 aa AA seqDB search
MQFANCRTVKRSLPIFLRGGDTGVLLVHGFTGSPHDFEYMANELNKAGLTVSVPRLPGHG
TCGKDFLTTTRHDWLRRAYDAYYDLQGICKEVYIAGLSMGGVIALIMAADLKPKKLVTLA
AATHVFDKRIALAPLLALFKEKMVRQNDEQYDDPDLQYLKNEYWSYNWPKQAAELYKLMK
EARKKVPMITSDTLVVAARNDNTVPLSAAEFIYKNISSEKRKMLVFEKSGHVLSNDVEKE
EVTKAVIEWFLDK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgcgaattgtcgaacagtgaagaggtctttaccaatatttttgcgtggaggg
gatacgggagttcttttagttcacggttttactggctcaccgcatgattttgaatacatg
gcaaacgaattgaacaaagcaggtctcacggtttcagtaccacgactaccagggcatgga
acatgtgggaaggactttttaactacaacgcgtcacgattggttgagaagagcatacgat
gcctattatgacctccaaggcatctgtaaagaagtttatatagcaggactttcaatgggt
ggggtcatagcacttattatggcagccgatttgaaacccaaaaaactggtaacactcgca
gcagcaacgcatgtgtttgataaacgaatagccttggccccgttgttggcactcttcaaa
gagaagatggtcagacaaaatgatgaacagtacgatgacccagatttgcaatatctcaag
aatgaatattggtcatacaactggcccaaacaagcggcagaattgtataaactcatgaag
gaagcaagaaaaaaggttcccatgataacgagtgatactctcgtcgttgcagcaagaaac
gataacacagttccgctttcagcagctgagttcatatataaaaacattagctctgagaag
cgcaaaatgttagtcttcgaaaaatcagggcacgtgctcagtaacgatgtggaaaaagaa
gaggttactaaagccgtgatcgagtggtttttagacaagtaa

DBGET integrated database retrieval system