KEGG   Fervidobacterium pennivorans: Ferpe_1201Help
Entry
Ferpe_1201        CDS       T01808                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00010  Glycolysis / Gluconeogenesis
fpe00020  Citrate cycle (TCA cycle)
fpe00620  Pyruvate metabolism
fpe00640  Propanoate metabolism
fpe00650  Butanoate metabolism
fpe00680  Methane metabolism
fpe01100  Metabolic pathways
fpe01120  Microbial metabolism in diverse environments
fpe01130  Biosynthesis of antibiotics
fpe01200  Carbon metabolism
Module
fpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferpe_1201
   00020 Citrate cycle (TCA cycle)
    Ferpe_1201
   00620 Pyruvate metabolism
    Ferpe_1201
   00640 Propanoate metabolism
    Ferpe_1201
   00650 Butanoate metabolism
    Ferpe_1201
  Energy metabolism
   00680 Methane metabolism
    Ferpe_1201
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ferpe_1201
Enzymes [BR:fpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ferpe_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFG35289
UniProt: H9UCP6
Position
complement(1253889..1255058)
Genome map
AA seq 389 aa AA seqDB search
MPLKQAITGAEAIAYAMKQINPDVVAAYPITPQTPVVEYFAKYVADGVVDTEMIPVESEH
SAMSAVVGAAAAGARAFTATASVGLALMHEVVFIAASLRLPIVMAVANRALSGPINIHCD
HSDAMAERDSGWIQLWAENAQEAYDFTVMAYRIAEHPDVRLPVMVNFDGFIISHGVEVVE
TLDDDVVKNFVGKPIKMYPLLDTSKPVTYGPLDLYDYYFEHKRQQIEAMKHVPRVFKEVA
EEFAKISGRKYDLLDEFMVDDAEYIMVALGSTAGTIKHTVKELRAEGKKVGLVKPWVFRP
FVKSEFQRVLNARKGVVVLDRSASFGAEAPLYEAVKSALYEVAVRPQIGSYVYGLGGRDI
TPEHIRQAFEDAFKGNLIADEERYLGLRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaacaagcaattacgggagcggaagcgatagcttacgcaatgaaacagata
aatccagatgttgttgcggcatatccaattacgccacaaacacctgttgttgagtacttt
gccaaatacgtggctgatggtgtcgttgataccgaaatgattcctgttgagagtgaacac
tcagcaatgagtgcggttgttggtgcagcagctgcaggagcaagagcattcacagcaact
gcttctgttggtcttgcacttatgcacgaagtcgtatttattgctgcttctttgagactt
ccaatcgttatggcagttgccaacagggcgctttctggtccaatcaacatccactgtgac
cacagcgatgcgatggcagaaagagacagtggctggattcaactttgggcagaaaatgct
caggaagcatacgactttacagtaatggcatacaggatagcagaacatccagatgttaga
cttcctgttatggtcaatttcgatggatttataatctcccacggtgttgaagtagtcgaa
actcttgatgatgacgtagtcaaaaactttgttgggaaacccatcaaaatgtatccgtta
cttgatacatcaaaaccagtaacgtatggtccacttgacctttacgattactactttgaa
cacaagagacagcaaatagaagcgatgaagcacgttccaagagtgttcaaagaagttgcg
gaagaatttgcgaagatttctgggagaaaatacgaccttcttgacgaattcatggtagac
gacgctgaatatataatggttgcccttggttcaacagcaggaacaattaagcacacagta
aaggagcttagagcagaaggtaagaaggtcggactcgtaaaaccatgggtcttcagacct
tttgtaaaatccgaattccaaagagtgcttaacgccagaaaaggtgttgttgttcttgac
aggtctgcatcttttggtgctgaagctccactctacgaggcagtaaaatcagcgctctat
gaagttgcagtgagaccacagattggtagctatgtttacggtcttggtggaagagacata
acaccagaacacatcagacaggcatttgaagatgccttcaaaggcaacttgattgctgat
gaagaaagataccttggattaagagaataa

DBGET integrated database retrieval system