KEGG   Fervidobacterium pennivorans: Ferpe_1259Help
Entry
Ferpe_1259        CDS       T01808                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferpe_1259
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferpe_1259
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ferpe_1259
Enzymes [BR:fpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ferpe_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1303351..1304631)
Genome map
AA seq 426 aa AA seqDB search
MFREVVYLKPEEMPRSYYNVLADLPFKLDPPLDPKTGEPMRPEKLLRIFPEPLLEQEVSD
KRFIPIPEPVLKEYAVYRPTPLVRAHFLEEYLGTRTQIYYKYEGLSPTGSHKTNTALAQA
YYNKISGTKVLVTETGAGQWGSALSYAGAKFGLEVRVFMVKISYNQKPFRKVLMNLFDGN
VVPSPSKLTQFGQMFDEGHPGTLGIAISEAIETVLEEQNAKYALGSVLNHVLLHQTIIGL
ELKEQLKKLEITPDMIVACHGGGSNFGGTILPFIPDVLDGKDIEIVAVEPESCPSLTKGE
YRYDFGDSAGLTPMMKMYTLGKDFVPPAIHAGGLRYHGAAPIVSKLLYEKLISAAAVSQD
EVFEAGKLFAKVEGIVPAPESAHAIAYVIKEAKKNEKKTIVFTLSGHGYFDLNAYVSSLR
GNFRNF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtttagggaagttgtgtatttgaagcccgaggaaatgccaagaagttactacaacgtg
cttgcagacttgccattcaaattggacccaccacttgacccaaaaacaggtgagccgatg
agacccgagaagttgcttaggatattcccggaaccactgcttgaacaagaggtaagtgac
aaaagatttatccctattcctgagcccgttttgaaagaatacgcagtctacagacctaca
ccactcgttcgagcacactttcttgaagaataccttggaacgcgtacacagatttattac
aaatacgaagggctcagccctacaggtagtcacaaaacaaatactgctcttgcacaggct
tactacaacaaaatctcaggaacaaaagttttggtaaccgaaacgggtgcagggcagtgg
ggaagtgcactttcgtacgcaggtgctaagtttggcttggaagttcgagtatttatggta
aaaattagctataatcaaaagcctttcagaaaggtactaatgaatttatttgatggtaac
gtagttccaagtccgagcaagttaacgcaatttggtcagatgtttgacgaagggcaccct
ggaacacttggtatagcgatttcagaggctattgaaacagtccttgaagaacaaaatgca
aagtatgcacttggaagtgttttgaaccatgtgttactacaccaaacgataattggactc
gaattgaaagagcaattaaaaaagttagaaattacgccagacatgattgttgcatgccat
ggaggtggttctaatttcggtggaacgatattgccttttattcctgatgttctcgatggg
aaagatatcgaaattgttgcggtagagcccgagagctgtccgtcactgacaaaaggtgag
tatcgatatgactttggagatagcgcaggtttgacaccaatgatgaaaatgtacacactt
ggtaaggactttgttcccccagcaattcacgcaggtgggttaagataccacggagcagcc
cctattgtctcaaagttactctacgaaaaactgatatccgctgcagcggttagtcaggat
gaggtcttcgaagccggaaagctttttgcaaaagtggagggaatcgttcctgcaccagaa
tcggcacacgcaatagcatatgtgattaaggaagcgaaaaagaatgagaaaaagacaatt
gtcttcacactttctggtcatggatattttgatttgaatgcgtatgtcagttcgttaagg
ggaaactttagaaacttttga

DBGET integrated database retrieval system