KEGG   Fervidobacterium pennivorans: Ferpe_1329Help
Entry
Ferpe_1329        CDS       T01808                                 

Definition
(GenBank) chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe02020  Two-component system
fpe02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ferpe_1329
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ferpe_1329
Enzymes [BR:fpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ferpe_1329
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Ferpe_1329
Two-component system [BR:fpe02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Ferpe_1329
Bacterial motility proteins [BR:fpe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ferpe_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest DUF1188 YcgL DUF5076 ANAPC2
Motif
Other DBs
NCBI-ProteinID: AFG35406
UniProt: H9UD13
Position
1372422..1373015
Genome map
AA seq 197 aa AA seqDB search
MANAKKVIIVGSAGSPSQAVEILKLGEKLNFPVIVNIHFTSSAIETFAQHIRSETNQKVT
IVKGPVFLEPGVYIPEGGKDLIFLGSNAVTVVDETTSKETIHPSISILFSSMKKFANKDF
VVIVLGGLGGDGAEHVSELKKKGVYFIIERTPKFPYLPENIAKQLGERYEKLEIEKIREM
LKMFNAEAKQQTKDTNA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgcaaagaaagtaattatcgtcggttcagcaggaagtccttcgcaagctgtt
gagatactaaaactcggtgagaaattgaattttcctgtcatagttaatattcattttaca
agtagtgcaatagaaacttttgcacagcatatacgttctgaaacaaatcaaaaagtcaca
atagtaaaaggacctgttttcttagaacctggagtatacataccagaaggcggaaaagac
ttgatttttctaggcagtaatgccgttactgttgttgatgaaaccacttcaaaagaaacg
attcatccttccatatctattctgttcagttcaatgaagaaattcgccaataaagatttc
gtagtaatagtccttggcgggttagggggcgatggtgcagaacatgttagtgagctgaaa
aagaaaggtgtctatttcataatagaaagaaccccgaaatttccatacctccctgaaaat
attgctaaacaacttggagagcggtacgaaaaactggagattgaaaaaataagggaaatg
cttaaaatgtttaacgctgaggcaaaacaacaaacaaaagacaccaacgcatga

DBGET integrated database retrieval system