KEGG   Fervidobacterium pennivorans: Ferpe_1329Help
Entry
Ferpe_1329        CDS       T01808                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:fpe02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:fpe02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1372422..1373015
Genome map
AA seq 197 aa AA seqDB search
MANAKKVIIVGSAGSPSQAVEILKLGEKLNFPVIVNIHFTSSAIETFAQHIRSETNQKVT
IVKGPVFLEPGVYIPEGGKDLIFLGSNAVTVVDETTSKETIHPSISILFSSMKKFANKDF
VVIVLGGLGGDGAEHVSELKKKGVYFIIERTPKFPYLPENIAKQLGERYEKLEIEKIREM
LKMFNAEAKQQTKDTNA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgcaaagaaagtaattatcgtcggttcagcaggaagtccttcgcaagctgtt
gagatactaaaactcggtgagaaattgaattttcctgtcatagttaatattcattttaca
agtagtgcaatagaaacttttgcacagcatatacgttctgaaacaaatcaaaaagtcaca
atagtaaaaggacctgttttcttagaacctggagtatacataccagaaggcggaaaagac
ttgatttttctaggcagtaatgccgttactgttgttgatgaaaccacttcaaaagaaacg
attcatccttccatatctattctgttcagttcaatgaagaaattcgccaataaagatttc
gtagtaatagtccttggcgggttagggggcgatggtgcagaacatgttagtgagctgaaa
aagaaaggtgtctatttcataatagaaagaaccccgaaatttccatacctccctgaaaat
attgctaaacaacttggagagcggtacgaaaaactggagattgaaaaaataagggaaatg
cttaaaatgtttaacgctgaggcaaaacaacaaacaaaagacaccaacgcatga

DBGET integrated database retrieval system