KEGG   Fervidobacterium pennivorans: Ferpe_1344Help
Entry
Ferpe_1344        CDS       T01808                                 

Definition
(GenBank) peptidase family protein
Organism
fpe  Fervidobacterium pennivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1390007..1391014)
Genome map
AA seq 335 aa AA seqDB search
MFKYLKELTEISGPSGNEDAVREYIKEKISGKVDEIFIDRMGNLIAFKKGKGNGKKILLD
AHMDEVGFIVTNINEDGTLSFAPVGGVDTRVIIGKKVKIGKDVVGIIGYKAIHLQKDGYM
NAPKYSELKIDIGAKSKAEAEKQVKIGDYVSFITPYEEQGGFIIAKALDDRCGCSVLMDL
IDENIETQNDIYFAFTVQEETGLRGPAIIAEQLKADIAIAVETTTSGDDPELEKQLWSTH
LGDGPAITFMHSGYVVHQAIFEKLIETAKQFNIPFQYKMRTVGGTNARRYALTGIPAGVV
SVPARYIHSPVSVISKKDYEHTIALLKEFLKRKDF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatacctgaaagagctcacagaaataagtggaccttcgggaaatgaagacgca
gtgagagaatatataaaggaaaaaatctctgggaaagttgatgagatatttatagacaga
atggggaatttaattgcttttaaaaaaggtaaaggcaatggaaagaaaattttgctcgat
gcacatatggacgaagtaggattcatagtcactaacatcaacgaagatggaactctttcc
ttcgcaccagttggtggagtggatacgagggtaatcattggaaaaaaggtaaagattgga
aaagatgttgttggtataattggttacaaggcgatacacctgcaaaaagatggatacatg
aacgcgccgaaatacagtgaactaaaaatcgacataggagcgaaatcaaaagcggaagct
gaaaagcaagttaaaataggagactatgtttcatttatcacaccttacgaagagcaagga
ggctttatcatcgcaaaagcgttggatgataggtgtggatgcagtgtgttgatggactta
attgatgagaatatcgaaacacaaaacgatatatactttgcctttacagtccaagaagag
acagggctaagaggacctgcgataatcgccgaacaactcaaagcagatattgctattgct
gttgagacaacaacaagtggagatgacccggaactcgagaaacaactgtggtcaacacac
cttggtgatggaccagctatcacatttatgcacagcggatatgtggttcatcaggcaata
tttgaaaagcttatcgaaacagcaaagcagttcaacataccattccagtacaaaatgcgc
actgttggtggtacaaacgcaagaagatacgcgctcacgggtattccggcgggtgttgtt
tccgtcccggcaaggtatattcactcgcctgtttccgtgattagcaagaaagattacgaa
cataccattgctttgttgaaagaatttcttaaacgcaaggatttttaa

DBGET integrated database retrieval system