KEGG   Fervidobacterium pennivorans: Ferpe_1452Help
Entry
Ferpe_1452        CDS       T01808                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00010  Glycolysis / Gluconeogenesis
fpe00030  Pentose phosphate pathway
fpe00051  Fructose and mannose metabolism
fpe00052  Galactose metabolism
fpe00680  Methane metabolism
fpe01100  Metabolic pathways
fpe01110  Biosynthesis of secondary metabolites
fpe01120  Microbial metabolism in diverse environments
fpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferpe_1452
   00030 Pentose phosphate pathway
    Ferpe_1452
   00051 Fructose and mannose metabolism
    Ferpe_1452
   00052 Galactose metabolism
    Ferpe_1452
  Energy metabolism
   00680 Methane metabolism
    Ferpe_1452
Enzymes [BR:fpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ferpe_1452
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Ferpe_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFG35521
UniProt: H9UDC8
Position
complement(1480301..1481479)
Genome map
AA seq 392 aa AA seqDB search
MKALYAQSGGVTSVINASAYGVIDEARKNGLEIYVGINGVTGILKERFLDATELDIEFLR
YTPAGAFGSCRKKLKSDADIEKLFEIFRKNDIRYFFYNGGNDSMDTAWRLQAEAQKRGYE
LKVVGVPKTIDNDLPHTDHCPGYGSAAKYIAIAMMEAALDLRSMYVDSTQVFVMEIMGRH
AGWLAAAAALGWVNGIGADIVLLPEEPFNKDEFISAVDNIVSRKGHCAIAVAEGLKYPDG
FFVSDMGYTDSFGNRQLGGVGFTIAGMVRSELGLKTHVAIPDYLQRSGRHIASATDVQEA
EMCGRMAVRYALEDNYGVMVTMERVSDEPYEIRYSSVPLNLVAEQTRMLPKDYFDKFMVT
EKFFKYALPLIQGEPYPPFRNGLPDYKLLDLK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttgtacgcacagtctggtggtgttacaagcgttatcaacgcaagtgcctat
ggtgttatagatgaggcaagaaagaacggtttggaaatatacgtgggaattaacggtgtt
acgggtattttgaaggagagatttctggatgcaacagagcttgacatagaatttttgagg
tacacacctgcaggtgcgtttggttcttgtagaaagaagttaaaaagtgatgctgatata
gagaagctttttgagatttttaggaaaaatgatattagatatttcttctacaacggtggc
aacgattctatggacaccgcttggagattgcaggccgaagcacaaaaaagaggttacgaa
ttgaaagttgttggagtccccaagactattgataatgaccttccacatacagaccattgt
cccggatacggctcagccgcgaaatatattgctatagctatgatggaggctgcacttgat
ttaagaagcatgtatgtggactctactcaggttttcgtcatggaaatcatgggaagacat
gctggttggttagcagctgccgcagctttaggttgggtaaacggtatcggtgcagatatt
gtgttgttaccagaagagccgtttaataaagatgaatttatttctgcggtagataatatt
gtttccaggaaaggtcactgtgctatcgctgttgcggagggtttgaaatatccggacggg
ttctttgtctccgatatgggatacaccgatagttttggtaatcgccaacttggaggtgtt
ggattcacgattgctggtatggttaggtctgagttaggactaaaaacccacgtggcaatc
ccagattatttacaaaggagtgggagacatattgcaagcgcgacagacgtccaagaagct
gagatgtgtggaagaatggccgttagatatgctttggaggataattacggtgttatggtt
actatggagcgcgtttcggatgaaccgtatgaaattagatactcttctgttcctctgaat
ttggttgcggaacaaacaaggatgctcccaaaagattatttcgacaagttcatggtaaca
gaaaagttcttcaaatacgcactaccattgatacagggagagccgtatccaccattcaga
aacggactgccggattacaagctgttggatttaaagtaa

DBGET integrated database retrieval system