KEGG   Fervidobacterium pennivorans: Ferpe_1774Help
Entry
Ferpe_1774        CDS       T01808                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferpe_1774
   01230 Biosynthesis of amino acids
    Ferpe_1774
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferpe_1774
   00030 Pentose phosphate pathway
    Ferpe_1774
   00051 Fructose and mannose metabolism
    Ferpe_1774
   00052 Galactose metabolism
    Ferpe_1774
  Energy metabolism
   00680 Methane metabolism
    Ferpe_1774
Enzymes [BR:fpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ferpe_1774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1836819..1837748
Genome map
AA seq 309 aa AA seqDB search
MIFTLTMNPCLDRYIYVDELIVDDTIRAKKVVDYPAGKGIDVSRVIRELGGVSIAIALVG
GANGRRLEEMLDKEGVIYSSIRVPQETRMNIILETSKGQYRISMPGEKIGVKKLQVVLEV
LNALVRQGDVVVVSGSLPKGVAAEFYTGIIFTLKQWGATVYFDSDGDKLKAGLIGQPDYI
KPNLHEFQRLIGKNVSSREEIISEARKVIEIHELKAILLTLGGEGAYFISNEKVLYTKTI
KVPVKSAVGAGDSFLAGFVLKKTEGASDEEALRWANASGTAAVMTPGTRLCRKSDVEKLL
EKVEVERIE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatatttactttaactatgaacccatgccttgataggtacatttatgttgatgaatta
attgtggatgatactatccgtgccaagaaagttgttgattacccagcaggtaaaggaata
gacgtttcgcgtgtaatcagagaacttggaggagtatcgatagctattgcgcttgttggt
ggagctaacggtagaaggcttgaagagatgcttgataaggaaggagtcatatactcatcc
atacgcgttcctcaagagacgagaatgaatattatcttggaaacgagcaaagggcaatat
cgaataagtatgcccggtgaaaaaataggtgtgaagaaattgcaggttgttttggaagtg
ctcaatgccttggtgcgccagggagatgttgttgtagtgtccggtagccttccaaaagga
gttgcagccgagttctatactggaatcatctttactttaaaacaatggggagcaactgtt
tactttgactctgatggagataaactaaaagctgggttgataggccaaccggattatatt
aagccaaatttacacgagtttcaaagattgataggcaaaaatgtatcctctagagaagaa
attatctcagaagcgagaaaggttatagaaattcacgaactgaaggctattcttttaact
cttggcggtgaaggtgcatattttatttctaacgaaaaagtattgtacacaaaaaccata
aaggttcctgttaaaagtgcagttggcgctggtgattctttccttgcggggtttgtgttg
aagaaaacagaaggtgcttctgatgaggaagcgttgagatgggcgaacgcatcaggaaca
gcggcagtcatgacccctggaacgaggctgtgtagaaaatccgatgtggaaaaattactt
gagaaagtggaagtggagagaatagagtag

DBGET integrated database retrieval system