KEGG   Fervidobacterium pennivorans: Ferpe_1841Help
Entry
Ferpe_1841        CDS       T01808                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ferpe_1841
Enzymes [BR:fpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Ferpe_1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1914230..1915312)
Genome map
AA seq 360 aa AA seqDB search
MVERHFRYVLICILFLVMLLISSTQCGKNEPNKGVNSMDQSVAESDSNSALEYNKIIGKG
VNIGNALEAPFEGAWGVRIEDEYFEIIKKRGFDSVRIPIRWSAHISEKPPYDIDRNFLER
VKHVVDRALENNLTVIINTHHFEELYQEPDKYGNVLVEIWRQIAKFFKDYPENLFFEIYN
EPAQNLTAEKWNELYPKVLKVIRESNPTRIVIIDAPNWAHYSAVRSLKLVNDKRIIVSFH
YYEPFNFTHQGAEWVNPTPPVGVKWNGEEWEINQIRSHFKYVSDWAKQNKVPIFLGEFGA
YSKADMDSRVKWTESVRKMAEEFGFSYAYWEFCAGFGIYDRWSQNWIEPLATAVVGESKE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaagacacttcagatatgttcttatttgcatcctgtttcttgttatgctccta
atctcatccactcagtgtggaaaaaatgaaccaaacaaaggagtgaatagcatggatcag
tcagttgctgaaagtgatagcaactcagcacttgaatacaacaaaattataggtaaagga
gtaaatattggaaatgctttagaagctcctttcgaaggagcttggggagtaagaattgag
gatgaatattttgagataataaagaaaaggggatttgattctgttaggattcccataaga
tggtcagcacatatatccgaaaagccaccatatgatattgacaggaattttctcgaaaga
gttaagcatgttgtcgatagggctcttgagaataatctaacagtaatcatcaatacgcac
cattttgaagaactttatcaagaaccggataaatacggcaatgtcttggtggaaatttgg
agacagattgcaaaattctttaaagattacccggaaaatctgttctttgaaatctacaac
gagcctgctcagaatttgacagctgaaaaatggaacgaactttatccaaaagtgctcaaa
gttatcagggagagcaatccaacccggattgtcattatcgatgctccaaactgggcacac
tatagcgcagtgagaagtctaaaattagtcaacgacaaacgcatcatagtctccttccat
tactacgaacctttcaatttcacacatcagggtgccgaatgggttaatcccactccacct
gttggagtcaagtggaatggcgaggaatgggaaatcaaccaaatcagaagtcatttcaaa
tacgtgagcgattgggcaaagcaaaataaagtgccaatctttcttggtgaattcggtgct
tattcaaaagcagacatggattcaagggttaagtggaccgaaagtgtgcgaaaaatggcg
gaagaatttggattttcgtatgcgtactgggaattttgtgcagggttcggcatatacgat
agatggtctcaaaactggatcgaaccattggcaacagccgtggttggagaaagcaaagaa
taa

DBGET integrated database retrieval system