KEGG   Fervidobacterium pennivorans: Ferpe_1907Help
Entry
Ferpe_1907        CDS       T01808                                 

Definition
(GenBank) galactose mutarotase-like enzyme
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00010  Glycolysis / Gluconeogenesis
fpe00052  Galactose metabolism
fpe01100  Metabolic pathways
fpe01110  Biosynthesis of secondary metabolites
fpe01120  Microbial metabolism in diverse environments
fpe01130  Biosynthesis of antibiotics
Module
fpe_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:fpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferpe_1907
   00052 Galactose metabolism
    Ferpe_1907
Enzymes [BR:fpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Ferpe_1907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFG35956
UniProt: H9UEL3
Position
1991224..1992309
Genome map
AA seq 361 aa AA seqDB search
MNNTSVYGSVEQSLFGHTQEGIPVHEYTLINKHGLMMKVLSLGGIVRELWVPDKNGRFVD
VVLGFNSVEEYERNPGYLGAIIGRFANRIDNGRFQIDGVTYQLALNDGGGKRPNALHGGV
KGFDKRVWKTFAEVTPEGPKVILKLRGHDGEEGYPGNLDVTVIYTLTNENEWKIEYFATA
DKPTIVNLTQHTYFNLNGGGKIYNHCVLIRAEKYTPVNENLIPTGEIAPVEGTSYDLRKQ
ISIKEAIARLRNEYPNLKGFDINYVLSENHENIERFAGSVYSEVTGVRMEVYTTQPGLQF
YTGNYLQGFQGKYCQIYDEHTGFCLETQHFPNSPNHENFPKTVLRPGDIYHYVTRFKFLI
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaacacaagtgtttacggctcagttgaacaaagcctgttcggacatacgcaagag
ggtatacctgttcacgaatacacactaattaataaacacggtttaatgatgaaagtcctt
tcgttgggtggcattgttcgtgagttatgggtaccggataaaaacggaaggtttgttgac
gttgtacttgggttcaacagtgttgaggaatacgaacgcaatccgggatacctcggggct
attattggtcggtttgcaaaccgaattgataatggaagattccaaattgatggggttacc
tatcaactggcattaaacgacggtggtgggaaaagacccaacgcgttgcatggaggtgtg
aagggttttgacaagagggtttggaaaacctttgctgaagtaactccggaaggtccgaag
gttatcttgaaactccgcggtcacgatggagaagaaggttatcctggaaatctggacgta
acagttatttacactttaactaacgagaacgaatggaaaatagagtattttgcaacggct
gacaaacctacgatcgtaaatttaacgcagcatacatacttcaacctaaatggtggtggt
aaaatctacaatcattgcgttctaataagagcagaaaaatataccccagttaatgagaat
ttaattccaacaggagaaattgcaccagttgaaggcacatcctacgatttgcgaaagcaa
ataagtataaaagaagctatcgctcggctaaggaatgaatatccaaacctgaaaggattt
gacattaactatgtgctttcggaaaaccacgaaaacattgaaagatttgcaggaagcgta
tacagtgaagtgaccggagtaagaatggaggtctacacaactcagcctgggttgcagttt
tacacgggaaattacttacaggggttccaaggaaaatattgtcaaatctacgatgagcat
acgggtttctgtcttgagactcagcattttccgaattcaccaaaccatgaaaactttcca
aaaacagtgttaagaccaggggatatataccactacgtaacacgtttcaagttcttgata
ggctaa

DBGET integrated database retrieval system