KEGG   Fervidobacterium pennivorans: Ferpe_1963Help
Entry
Ferpe_1963        CDS       T01808                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fpe00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2057923..2058576
Genome map
AA seq 217 aa AA seqDB search
MDGKDFDVQNEVHAEGILFVISGPSGVGKTSIIRSVLERVERVVFSVSCTTRKQRPGEIH
GVDYFFVSHEEFERMIKENKFIEWAKVHDNYYGTPAEMVYDNIRKGLDVILDIDVQGALT
VKKNFSGAKFIFIAPPSYEVLRERLKKRGTETEEKIQKRLETAKRELKFIPEFEYLIINE
DLEESIRNLMSIIYAERLKFERIKNTSKVKRLMEEVQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatggtaaggactttgatgtgcaaaacgaagtccatgcggaaggaatactgtttgtt
ataagtggtccgagcggtgttggtaaaacaagtattattagatccgttcttgagagagtt
gagcgagttgtcttctccgtctcgtgcacaactcgaaaacaaagacctggagagatacac
ggagtggactatttctttgtgtcgcacgaagaatttgaaagaatgataaaagaaaacaaa
tttatcgaatgggcaaaggttcatgacaactactatggaacacctgcggagatggtctac
gataacataagaaagggtttggatgtgatacttgacatagatgttcaaggtgctttaact
gttaagaagaatttttcgggtgccaagtttatttttattgcaccaccaagttacgaagtt
cttagagagaggcttaaaaaaaggggaacggaaacagaagagaaaatacaaaaaaggtta
gaaactgccaagagggagcttaagttcataccagaatttgaatacttaataatcaatgaa
gacttagaagaatcgataagaaacttgatgtccataatctacgcagaaagattaaagttt
gaaaggattaaaaatacttccaaagtgaagcggttgatggaggaggtgcaataa

DBGET integrated database retrieval system