KEGG   Fervidobacterium pennivorans: Ferpe_2003Help
Entry
Ferpe_2003        CDS       T01808                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fpe  Fervidobacterium pennivorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fpe00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:fpe00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:fpe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2103386..2104696
Genome map
AA seq 436 aa AA seqDB search
MKLRGFVLLFLVFVTIISFALNIIYLVGDGMSFNQLLLASILEGRVLTTMTLPYTAIQTT
YSADSWVTDSAPAGTALFAGYKTLNSAIGVLPNGTPMPSIFEIAKSAGYNIGLAVTCRVT
HATPASMYGHVTNRNDEVILAKQLAESGTVDVIFGGGWDMFVPTAQGGRRTDGLNLIEVM
KSKGYEYITTVEQLNTVQSSKVLGLFAKGHLDPVSNRSSAQPTLDVMTKKALELLSKDGK
PFMLMVEGSQIDWEAHSNDFYGVWKEVVEFDNAVKVALEFAAKDGNTLVIVTGDHETGGL
SLSKGGYTINVELARKAKGTTQMFLSQYNIADKEKFIAGLKEWYGISITDAEYENLRQIP
SNNLRRELARFVSEKVGFGWTTFDHTAAPVPVYAFGPGAHYFTGFMDNTDIPKIIMKITK
LSAISFPEVKTTGSGY
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaggggtttcgtgttgttatttttagtatttgtaaccattatctcatttgcg
ctgaatattatttaccttgtcggagatggtatgagttttaaccagcttcttcttgcaagt
atacttgaaggaagagttttgacaactatgacattgccttacacagctatacaaacgact
tactctgctgattcatgggtgacagattctgctccagcggggacggccctctttgccgga
tacaaaacattgaacagtgcgataggcgtattaccaaatggtacaccgatgccttcaata
tttgaaattgcaaagagcgctggttacaacattggtttggcagttacgtgtagggtaact
catgccacaccagcctcaatgtacgggcacgtaacaaatagaaacgatgaagtaatcctt
gctaaacagctcgctgaatctggaactgttgacgtcatttttggtggcggatgggatatg
tttgtcccaactgcgcaaggtggtagaagaacagatgggcttaatctcatagaagtgatg
aaaagcaaagggtatgaatatataacaacagttgaacaacttaatactgttcagtcttca
aaggttcttggtttatttgccaagggacatcttgacccagtttctaacaggtcatcagct
caaccaaccctcgatgttatgaccaaaaaagccctcgaacttctttcaaaggatggtaaa
cctttcatgctcatggttgaaggctcacagatagattgggaagcacattcgaacgatttc
tacggagtttggaaagaggttgtggaatttgataacgctgtcaaagttgctctcgaattt
gcagctaaagatggtaacacacttgtgattgttaccggtgaccacgaaacaggtggattg
tcactttcaaaaggtggttacacaattaacgtggaacttgcaagaaaggcaaaaggaact
acacagatgttcttaagccaatacaacatcgcagataaagaaaaatttattgcgggtctt
aaagaatggtatggtatatctatcacagatgccgaatacgaaaacttgagacagattcct
tcaaacaatctgagaagagaacttgcaaggtttgtaagtgaaaaagttggatttggctgg
acaacgtttgaccacacagctgcacccgtcccagtctacgcttttggacccggtgcacat
tatttcacaggttttatggacaacacggacattcctaagattattatgaagataacaaaa
ctttcggcaatttcatttcctgaagttaaaacaaccggtagtgggtattaa

DBGET integrated database retrieval system