KEGG   Falco peregrinus (peregrine falcon): 101910609Help
Entry
101910609         CDS       T02856                                 

Gene name
PPOX, USP21
Definition
(RefSeq) uncharacterized LOC101910609
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101910609 (PPOX)
Peptidases [BR:fpg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101910609 (PPOX)
Ubiquitin system [BR:fpg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101910609 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 998 aa AA seqDB search
MPQASEHRIGRARDHAVITSQPKAATKLPSGHRALSQERHAASLASATAANGLSPAPKLR
LLPPRPGSLDDRGKKLELDRGRASKRGEAVRSSACRRGPMKADHAVRVPGSPQAGAVLGS
ASFSLPAGASLAGREAERRRSNLARSKSISIGDLSQGGGGGGGGRAEDVAAVLSRLVLRD
CSHQLSAGSLALKRSSSLRRVNVSSGLDGKPATPLLSVRPEGCPRTRTAPDPPYAHSPNV
PAPGSPALGRVPAPGRTEEKAAATHHTLLLGSGHVGLRNLGNTCFMNAVLQCLSSTKPLR
DYCLRRDFQQEQPPGSRAPQELTEAFADVIAALWHPDSSEAVNPGRFKAVFQKYVPSFTG
YSQQDAQEFLKFFMDRLHVEINRKGRRTPSILSDTRRTPALEDPEMLSDDERANQMWKRY
LEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKSFAGGKVSLHDCFSL
FTKEEELDSENAPVCDKCRQRTRSTKKLTIQRFPRILVLHLNRFSTTRYSIKKCSVFVDF
PLQQLNLREFASEKAEAGARLGGWLQSTRTADGAVFEHGPRGIRPGGVVGTDTLHMVSEL
GLEGDVLPVPGDHPASRNRFLYTGGALHKLPSGLQGLLWPVPPFSRALLWSGVRDLLAPA
GTEPDESVYAFVHRRFGQEVADIAVDSLCRGVFAGDCRALSIRSCFPTLFKAERHRRSVL
LGLALGSRKERGAESRLSQRARAEHWSQWSLRGGMESLAEALAAFLRPRGVELHCHAPLR
RLRWHPSGHWQLILADSTVTADHVVSALPAAALAEVLPAEAEPLAQELRRIPAVSVAVVN
LQYEGITLPVTGFGHLVPSSEDASLLGIVYDSVAFPQHNGTGATSVRLTVMLGGAWFRQS
FGDPAAVAPALLLQRAKAAVREQLGLEPAPTRSIVKVHQACIPQYTLGHWQRIERIGRFL
AEQQLPLSLIGASYTGVSVNDCIASAKAAVGRLLGQLH
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagcctcggagcaccgcatcggccgggccagggaccatgctgtcatcacctca
cagcccaaggctgccacgaagctgcccagcgggcaccgggccctgagccaggagcgccat
gctgcctccctggcctctgccaccgctgccaacgggctctccccggcacccaagcttcgc
ctcctgccaccccggcctggctcgctggacgaccgcggcaagaagttggagctggaccgg
ggtcgggcctcaaaacggggggaggctgtccgcagctcggcctgccggcgggggcccatg
aaggcagaccatgcggtgcgtgtgcctggttctccccaggcaggtgctgtgctgggcagc
gcctccttctccctgcctgctggggcctcgctggcggggcgcgaagcagaacgccggcga
agcaacctggcccgctcaaaatccatcagcatcggggacctgagccagggtggtggtggt
ggtggtggtggccgtgctgaggacgtggcggcagtgctgagccggctggtgctgagggac
tgtagccatcagctgagtgctggctcgctggctctcaagaggagctcctctctccggagg
gtcaacgtctcttcagggctggatgggaagccggccaccccgctgctgtctgtccggcct
gagggctgcccaaggactcgtactgcccccgaccccccgtacgcccacagccccaacgtt
ccagcacccggcagccccgccctgggcagagtcccggcacccggcaggaccgaggagaag
gcggcagccacccaccacaccttgctgctgggctcgggccacgtcggcctcaggaacctg
ggcaacacgtgcttcatgaacgccgtgctgcagtgcctgagcagcaccaagcctctgcgg
gactactgcctgcgccgggacttccaacaggagcagcctcctggctcccgtgccccccag
gagctcaccgaagccttcgctgatgtgatcgctgccctctggcaccctgactcctctgag
gctgtcaaccccgggcgtttcaaggctgtctttcagaaatacgtcccctccttcaccgga
tacagtcagcaggatgcacaggagttcctcaagttcttcatggatcggctgcatgtggag
atcaaccgcaagggtcgcagaacccccagcatcctctcagacacccggcggacccccgcg
ttggaggaccctgagatgttgagcgacgacgaacgcgccaatcagatgtggaagcgatac
ctggagagggaggacagtaagattgtggacctctttgtggggcaactgaagagctgcctc
aagtgccaggcttgcggctaccgctccaccacctttgaggtcttctgcgatctctccctg
cccatcccaaagaaaagctttgctggggggaaggtctcactccatgactgcttcagcctc
ttcaccaaggaggaggagctggactcggagaatgccccggtctgcgacaagtgccggcag
cggacgcggagcacgaagaagctgaccatccagcgcttcccccgcatcttggtgcttcac
ctgaaccggttctccaccacccgctactccatcaagaagtgctccgtcttcgtggacttc
ccgctgcagcagctcaacctgcgggagtttgccagtgagaaggcagaggccggcgcccgc
ctaggggggtggctgcaaagcacccgcaccgccgacggggccgtgttcgagcacgggccc
cggggcatccgccccgggggcgtggtgggcaccgacaccctgcacatggtctctgagctc
ggcctggagggtgacgtcctgcctgtccctggagaccacccggcttctaggaaccgattc
ctctacaccggcggagccctgcacaaactgccctcaggcctgcagggcctgctgtggcca
gtgccccccttctcgcgggcactactctggagcggggtgcgggacctgctggcaccagcc
gggacggagcctgatgagagcgtgtacgcctttgttcatcgccgcttcggccaggaggtg
gccgacattgctgtggacagcctgtgccggggtgtgtttgctggggactgccgagcactg
agcatccgctcctgtttccccacgcttttcaaggccgagcggcaccggcgatctgtcctg
ctggggctggcgctgggctccaggaaggagcgtggggctgagtcaaggctgagccagcgg
gcgcgggccgagcactggagccagtggtcactgcggggtgggatggagagcctggccgag
gcgctggcggccttcctgcgcccacgtggggttgagctgcactgccatgcacccctgcgc
cgcctgcgctggcaccccagtggccactggcagctcatcctggcagacagcaccgtgaca
gctgaccatgtggtcagtgccctcccggccgcagccctggcagaggtgctgccagccgag
gctgagccactggcacaggagctgcggcgcatcccagctgtgtctgtggctgtggtgaac
ctgcagtacgagggcatcacattgcctgtcacgggctttgggcacttggtgccctcctcc
gaggatgcctcccttctgggtatcgtctacgactcggtggccttcccccagcacaacggc
acaggagccacctcggtgcggctgacggtgatgctgggaggtgcctggttcagacagagc
tttggggatccggcggcggtggcgccagcgctgctgctgcagcgggccaaggcagcagtg
cgggagcagctgggcctggagccagccccgacccgctccattgttaaggtgcaccaggcc
tgcattccccagtacacactgggccactggcagcgcatagagcgcatcggccgcttcctg
gcagagcagcagctgcccctcagcctcattggggcctcctacactggcgtctcggtcaac
gactgcattgccagtgccaaagcagctgttgggcgtctgctggggcagctgcactga

DBGET integrated database retrieval system