KEGG   Falco peregrinus (peregrine falcon): 101910636Help
Entry
101910636         CDS       T02856                                 

Gene name
MAOB
Definition
(RefSeq) amine oxidase [flavin-containing] B
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101910636 (MAOB)
   00330 Arginine and proline metabolism
    101910636 (MAOB)
   00340 Histidine metabolism
    101910636 (MAOB)
   00350 Tyrosine metabolism
    101910636 (MAOB)
   00360 Phenylalanine metabolism
    101910636 (MAOB)
   00380 Tryptophan metabolism
    101910636 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101910636 (MAOB)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101910636 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 416 aa AA seqDB search
MWNPLAYLDYNNLWRTMDEMGKEIPSEAPWKAPHAEEWDKMTMQDFIDKTCWTNAAKSFA
TLFVNVDVTSEPHEVSALWFLWYVKQCGGTARIFSTTNGGQERKFVGGSGQISEKIMERL
GSRVKLRKPVVHIDQLGESVIVETLDHELYEGKYVISAIPPALGLKIHFNPPLPPMRNQL
INRIPMGSVIKCIVYYKETFWRKKGYCGTMIIEDEDAAIGLTLDDTKPDGSFPAIIGFIL
ARKCRRLTGLTKEERKTRLCELYAKVLGSEEALHPVHYEEKNWCEEQYSGGCYTAYFPPG
IMTQYGRIIRQPIGRIYFAGTETATEWSGYMEGAVQAGERAAREILFAMRKIPDSEIWKP
EPESVDVPALPITTTFWERNLPSVPGLLKLIGFSTFFTSVAVAGLFAYKKGLLVRN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatccgttggcctacctggactacaacaacttatggaggaccatggatgaaatg
ggaaaggagattcccagtgaagctccatggaaggctccacatgcagaagaatgggacaaa
atgactatgcaagatttcatagataaaacttgctggacaaatgctgccaagagttttgca
actctgtttgtgaatgtggatgtcacttctgaaccccacgaggtctctgccctttggttt
ttgtggtatgtgaagcagtgtggtgggacagcaaggatattctcaacgaccaatggagga
caggagaggaagtttgttgggggctctggccagataagtgagaaaataatggagcgcctg
ggaagccgagtgaagctgaggaagccagttgtccacatcgaccagttgggtgaaagtgtc
atagtggaaacattagatcatgaattatatgagggcaaatatgtgatcagtgccattccc
ccagctcttggtttgaagattcatttcaacccacctttgcccccaatgagaaaccagctc
atcaaccgaattcccatgggttcggtcatcaagtgcattgtgtactataaggaaactttc
tggaggaagaaggggtattgtggtaccatgatcattgaagatgaggatgctgcaattggt
ttaacacttgatgatactaagcctgatggcagctttcctgccataataggcttcattctt
gctcggaaatgtagaaggctgacaggtctcacaaaagaagaaaggaagacgaggctgtgt
gagctctacgcaaaggttctgggatcagaggaagctttacatccagtgcattatgaagag
aagaactggtgtgaagagcagtattctgggggctgctacacagcctacttcccaccaggc
ataatgactcagtatggaaggatcattcggcagcccattggcagaatctattttgctggc
acagagacagccacagagtggagtggatacatggagggggctgtgcaggctggagaaaga
gcagccagagagatactgtttgctatgaggaaaatcccagacagtgaaatttggaagcca
gaacctgaatctgttgatgttccagctttgcccatcactacaaccttctgggagaggaac
ttgccatctgtgccgggactgctaaagctgattggattttccacattcttcacctctgtg
gctgtggctgggttatttgcttacaaaaagggacttctagttcgaaactga

DBGET integrated database retrieval system