KEGG   Falco peregrinus (peregrine falcon): 101911658Help
Entry
101911658         CDS       T02856                                 

Gene name
ABAT
Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101911658 (ABAT)
   00650 Butanoate metabolism
    101911658 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101911658 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    101911658 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101911658 (ABAT)
Enzymes [BR:fpg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     101911658 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     101911658 (ABAT)
Amino acid related enzymes [BR:fpg01007]
 Aminotransferase (transaminase)
  Class III
   101911658 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MASMLLSRQLTCCLQQNSRLLVFGHRYISQAAAKIDVDFDYDGPLMKTEVPGPRSRELMK
QLNGIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPSLIKLLQQPQ
NLSTFINRPALGILPPENFAERLKESLLSVAPKGLPQVITMSCGSCSNENAFKAIFMWYR
NKERGHTNVTKEELESCMINQPPGCPDYAMLSFMGGFHGRTLGCLATTHSKAIHKLDIPS
LDWPIAPFPRLKYPLEDFVKENQQEEARCLEEVEDLIVKYRKKKKIVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVVTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLMLAEVIKVIKREDLLNNATHAGKALLTGLL
DLQARYPHLISRVRGRGTFCSFDTPNDATRNKLITIARNKGVVLGGCGDRSIRFRPTLIF
KDHHAHLFLNIFSDILANFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatgttgcttagtcgacagctgacctgttgcctgcagcaaaactccaggctg
cttgtatttggacacagatatatcagtcaagccgctgctaaaattgatgttgattttgat
tatgacggacctctaatgaagacggaagttcctggaccacgatctagagaattaatgaag
cagctgaatggcattcagaatgcagaagctgtacactttttttgcaattatgaagagagc
agagggaactacctggtagatgtagatggcaatcgcatgctggatctctactctcagatt
tcatccattccaataggttacagccatccctctctgataaagcttctacagcagccacag
aacttgagcacttttatcaacagacctgctctagggattttacctccagagaactttgca
gaaagactgaaggaatctttgctatcagtggctcctaagggcctgccacaggtgatcacc
atgtcttgcggatcctgctccaatgaaaatgcctttaaagcaatatttatgtggtacaga
aacaaggagaggggccatactaatgtcacaaaagaggaactggaatcttgcatgattaac
cagccccccggctgccccgactacgccatgctctccttcatgggcggcttccacggaagg
accctgggttgcttagctacaactcactctaaagccattcataagttggacattccatcg
ctggactggcctattgctccatttccaaggctgaagtatcctctggaagactttgtgaaa
gagaatcaacaggaagaagcccgttgtttagaggaggtggaagacctgattgtaaagtac
aggaaaaagaagaagattgtggctggaatcattgtagaacccatccagtcagagggaggg
gacaaccacgcttcagatgacttcttcagaaagctacgagatattgccagaaagcatggc
tgtgcgttcttggtggatgaggtgcagacgggaggcggctgcacaggaaaattctgggca
catgaacactggggcctggatgacccagctgatgtggtaacgttcagtaagaagatgatg
acaggaggatttttccacaaagaggagttcaggccaaacgctccctatcgaatttttaac
acctggcttggagatccatccaagaacctcatgcttgctgaagtcattaaggttataaag
agagaagaccttctaaacaatgcaacccacgccgggaaagctctgctgactgggctgctg
gatttacaggctcgttatccccatctcatcagcagagtgagaggaagaggaacattctgt
tcgtttgacactccaaatgatgcaactagaaacaagttgattacaatagccagaaacaaa
ggtgtggtgctgggaggctgtggcgacagatcgattcgtttccgtccaacgctgatcttc
aaagatcaccatgcgcacctcttcctgaacattttcagtgatatcttagcaaacttcaag
taa

DBGET integrated database retrieval system