KEGG   Falco peregrinus (peregrine falcon): 101911799Help
Entry
101911799         CDS       T02856                                 

Gene name
LRRC4B, SYT3
Definition
(RefSeq) uncharacterized LOC101911799
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101911799 (LRRC4B)
Peptidases [BR:fpg01002]
 Cysteine Peptidases
  Family C86
   101911799 (LRRC4B)
Ubiquitin system [BR:fpg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    101911799 (LRRC4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1102 aa AA seqDB search
MSGDYEEDVCRSALRLVQELCFAPRARPPHDQGVPIFIERGGPKGPLQPNPPNLGQLQPE
LYRPGSTEPGGAGGGAPSPCGRLSVALRYAYGSQQLVVRVLRALDLPAKDANGFSDPYVK
IYLLPDRKRKFQTKVHRKTLNPVFDETFSFGVPFAELPARRLHFGVYDFDRFSRHELIGQ
VVLDNLLQAAERAPDLPIWRDIVEGGGVIGLCRVGSDAEGPGREHWAQMLANPRKPIEHW
HTLVEVIGLCRVGSDAEGPGREHWAQMLANPRKPIEHWHTLVEVCPHVSVPPSPPGALKP
DNAPWPWRPRRPLGCRCHWPRPSRRRRRPPAPPAAAPTSCPAACSCSNQASRVICTRREL
LEVPASISVNTRYLNLQENHIQVIRTDTFKHLRHLEILQLSRNLVRKVEVGAFNGLPNLN
TLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEY
ISEAAFEGLVNLRYLNLGMCNLKEIPNLTALVRLEELELSGNRLGRVRPGSFQGLGSLRK
LWLMHARVAAVERNAFDDLKALEELNLAHNELASLPHDLFAPLHRLERVHLHHNPWRCDC
DVLWLSWWLRETVPSNTSCCARCHAPPALRGRYLGELEPGHFTCYAPVIVEPPADLNVTE
GMAAELKCRTGTAMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQDTGQYTCM
VTNAAGNTTASATLNVSAADAAAAAAAAAAATGYTYFTTVTVETTDAGGEEPAPQTAPAP
TVGWENAGGSTAAPATRATGKPFTVPITAAAAGAGGGLQDLDDVLKTTKIIIGCFVAITF
MAAVMLVAFYKLRKQHQRHKHRGGPARAVEIVNVEDEEVDLVVEVAHPCVAQEHGEDILA
HADFMLGSPTVLADPAVEQRLRGAAARGGHTLYVPRGALWGCEDIARMDRAGTLAALKVT
MTKAPQSFRLEGWLQERLVAAGGTRTVLYEGPLRPLCPLAPNNVNTMAAAAVAAPHLGFD
GIQACLVADPSVPDWHIVEVEVTSVGDKGRALSVTSIRRNPAAPGAVTGSATRHAFPATD
MVDVSSSAEATRLGTAGDTRGE
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggactacgaggaggacgtgtgccgcagcgcgctgcgcctggtgcaggagctc
tgcttcgccccccgcgcccgccccccccacgaccagggggtccccatcttcattgagagg
gggggtcccaagggacccctgcaacccaacccccccaacttgggtcaactccaacccgag
ctctaccggccggggtccacggagccagggggggccggggggggagccccctccccctgt
ggccgcctgagtgtggcgctgcgctacgcctacggctcccagcagctggtggtccgcgtc
ctgcgcgccctcgacctccccgccaaggatgccaacggcttctccgacccctacgtcaaa
atctacctcctgcctgaccgcaagagaaagttccagaccaaggtccaccgcaagaccctc
aaccccgtcttcgatgagaccttcagcttcggggtgccctttgccgagctgcccgcccgc
cgcctccacttcggcgtctacgacttcgaccgcttctcgcgccacgagctcatcgggcag
gtggtgctggataacctgctgcaggcggctgagcgtgcccccgacctgcccatctggagg
gacatcgtcgagggtggcggggtgatcgggctgtgccgcgtgggcagtgacgcggagggg
cctggccgcgagcactgggcacagatgctggccaacccccgcaagcccatcgagcactgg
cacacgctggttgaggtgatcgggctgtgccgcgtgggcagtgacgcggaggggcctggc
cgcgagcactgggcacagatgctggccaacccccgcaagcccatcgagcactggcacacg
ctggttgaggtgtgcccccatgtgagcgtgcccccgtcaccacccggggccctgaagccg
gacaatgccccttggccatggcggccccggcgccccctaggctgccgctgccactggccc
cgcccgtcccgtcggcgccggcggcccccggctcctccggctgctgctccaacctcgtgc
ccagccgcttgttcctgcagcaaccaggcgagccgggtgatttgcacccgccgggagctg
ctggaggtcccagctagcatctcggtgaacacgcggtacctgaacctgcaggagaaccac
atccaggtgatccgcaccgacaccttcaaacacctgcggcacctggagatcctgcagctg
agccgcaacctggtgcgcaaggtagaggtgggcgccttcaacgggctgcccaacctcaac
accttggagctcttcgacaaccgcctgaccaccgtccccacccaagcctttgagtatctc
tccaagctgcgggagctgtggttgcgcaacaaccccatcgagagcatcccctcctacgcc
ttcaaccgcgtgccctccctgcgccgcctcgacctgggcgagctcaagcgcttggagtac
atctccgaagctgcctttgagggcttggtcaacctccgctacttgaacttggggatgtgc
aacctgaaggagatccccaacttgacggccttggtgcggttggaagagttggagttgtcg
gggaaccgcctggggcgtgtgcggccaggttccttccaaggcttggggagcttgaggaag
ctctggttgatgcacgcgcgcgtggcggcagtggagcgcaatgccttcgatgatctcaaa
gctttggaggagctgaatttggcccacaacgagctggcctcgctgccccacgacctcttc
gcccccttgcaccgcctggagcgggttcacttgcaccacaacccttggcgctgcgactgc
gacgtcttgtggttgagttggtggttgagggagacggtgcccagtaacaccagttgctgc
gcccgttgccacgcgccgccggcattgcgggggcgttacttgggggagctggaaccaggg
catttcacctgctatgcgccggtgattgtggaacccccggccgacctcaatgtcaccgaa
gggatggcggccgaactcaagtgccgtaccggcaccgccatgacgtcggtcaactggttg
acccccaacgggacgttgatgacccacggttcctaccgggtgaggatctctgtccttcac
gacggtaccctcaacttcaccaacgtcactgtgcaggacacggggcagtacacctgtatg
gtcaccaacgccgctggcaacaccaccgcctccgccacgctcaacgtctcggcagccgat
gccgccgctgctgctgctgccgctgctgccgctaccggttacacctatttcaccaccgtc
acggtggaaaccaccgacgccggcggcgaggaaccagctccgcaaaccgccccggcgccc
accgtcgggtgggaaaacgccggtggctccacagcggctccagccacccgtgccaccggt
aaacccttcaccgtccccatcacggcggcggcggcgggggcgggtggggggttacaggat
ctggacgacgtcttgaagaccaccaagatcatcatcgggtgcttcgtggccatcaccttc
atggcggccgtcatgctggtggcgttctacaagctccgcaagcaacaccagcgccacaag
caccgcggcggccccgcgcgcgctgttgagatcgtcaacgtagaggacgaggaggtggac
ctggtggtggaggtggcacatccctgcgtggcccaggagcatggcgaggacatcctggcc
cacgctgacttcatgctggggtcccccacggtgctggcggaccctgcggtggagcagcgg
ctgcggggggcggcggcgcgggggggtcacacgctctatgtcccccggggcgccctgtgg
ggctgcgaggacatcgcacgcatggaccgggctggcacgctggctgcgctgaaggtgaca
atgacaaaggccccacagagcttccgcctggaggggtggctgcaggagcggctggtggca
gcgggggggacacgcactgtcctctacgagggtcctctgcgtcccctctgtcccctcgcc
cccaacaacgtcaacaccatggcggccgcagcggtggccgcgccacacctgggcttcgat
ggcatccaggcctgcttggtggctgaccccagtgttcccgactggcacatcgtggaggtg
gaggtgacaagtgttggggacaagggacgggcgctgagtgtcaccagcatccgccgtaat
ccggcggcacccggtgctgtcactggcagtgccacccgccacgccttccctgccacggac
atggtggatgtgtccagctctgctgaggccaccaggctggggacagcaggggacaccagg
ggagaatga

DBGET integrated database retrieval system