KEGG   Falco peregrinus (peregrine falcon): 101911799Help
Entry
101911799         CDS       T02856                                 

Definition
uncharacterized LOC101911799
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101911799
Peptidases [BR:fpg01002]
 Cysteine Peptidases
  Family C86
   101911799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 496 aa AA seqDB search
MRGLVQRPRATWGLMQCRRARASCDAWPRAMASVPLYPSATPCPGATPCPQGPPTSQCHP
VSPESPSPGVNPCPQGPPVPQCHPTSPSPGATPCPQGPQHPSATPCPQSPRVLVSLCVPR
EVDLVVEVAHPCVAQEHGEDILAHADFMLGSPTVLADPAVEQRLRGAAARGGHTLYVPRG
ALWGCEDIARMDRAGTLAALKVTMTKAPQSFRLEGWLQERLVAAGGTRTVLYEGPLRPLC
PLAPNNVNTMAAAAVAAPHLGFDGIQACLVADPSVPDWHIVEVEVTSVGDKGRALSVTSI
RRNPAAPGAVTGSATRHAFVGLYHERQRLELCAVHALNNVLQRPCFTQEAADEICKRLAP
NAHLNPHRSLLGTGNYDVNVIMAALQSLELAAVWWDKRRSLERLALGQILGFILNVPSHV
SLGFVALPLRRKHWLAVRQLRGTYYNLDSKLRAPVAIGGEAELRAFLRDFLSQGLCEVFL
VVPRAVEEAGAWLSPE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcctcgtgcaacggcctcgtgcaacatggggcctcatgcagtgtcgtcgtgca
agggcctcgtgtgatgcctggcctcgtgcaatggcctcggtccccctgtaccccagtgcc
accccatgtcctggtgccaccccgtgtccccagggtccccccacatcccagtgccacccc
gtgtccccagagtccccaagtcctggtgtcaacccttgtccccagggtccccctgtaccc
cagtgccaccccacatccccaagtcctggtgccaccccgtgtccccagggtccccaacat
cccagtgccaccccatgtccccagagtccccgagtcctggtgtcactctgtgtccccagg
gaggtggacctggtggtggaggtggcacatccctgcgtggcccaggagcatggcgaggac
atcctggcccacgctgacttcatgctggggtcccccacggtgctggcggaccctgcggtg
gagcagcggctgcggggggcggcggcgcgggggggtcacacgctctatgtcccccggggc
gccctgtggggctgcgaggacatcgcacgcatggaccgggctggcacgctggctgcgctg
aaggtgacaatgacaaaggccccacagagcttccgcctggaggggtggctgcaggagcgg
ctggtggcagcgggggggacacgcactgtcctctacgagggtcctctgcgtcccctctgt
cccctcgcccccaacaacgtcaacaccatggcggccgcagcggtggccgcgccacacctg
ggcttcgatggcatccaggcctgcttggtggctgaccccagtgttcccgactggcacatc
gtggaggtggaggtgacaagtgttggggacaagggacgggcgctgagtgtcaccagcatc
cgccgtaatccggcggcacccggtgctgtcactggcagtgccacccgccacgccttcgtg
gggctgtaccatgaacggcagcgcctggagctctgtgctgttcacgcgctcaacaatgtc
ctgcagcgaccctgcttcacccaggaggctgcagatgagatctgcaagaggttggcaccc
aatgcccacctcaacccacaccgcagcctcctgggcactggcaactacgacgtcaacgtc
atcatggctgcactgcagagcctggagctggcggccgtttggtgggacaaacgccggtcg
ctggagcgtctggcgctgggtcagatcctgggattcatcctcaacgtcccctctcacgtc
tcgctgggttttgtggcattgccgttacgccgtaagcactggttagccgtccggcaactt
cgcggtacctactacaacctcgattccaaactccgggcgcccgtcgccatcggcggcgag
gctgagctgagggccttcctgcgggatttcctctcccaagggctctgcgaggttttccta
gtcgtgccgcgtgccgtggaggaagccggcgcctggttgagccccgagtga

DBGET integrated database retrieval system