KEGG   Falco peregrinus (peregrine falcon): 101911809Help
Entry
101911809         CDS       T02856                                 

Gene name
AGL
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fpg00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1559 aa AA seqDB search
MENQWFAQRARFSLPEVSLLARAGGPGEGRGPAKETRLLHLSEMEKLDKTLFRLEQGFEL
QFRLGPTLQGKPVTVYTNYPASGEVFDRHKFRTLSWHNPTGKEDDSDKYCKLDLQISGSY
QYYFSLGNEKSGGGYIVVDPILHVGADNHVLPLDCVTLQTFLAKCLGPFHEWEDRLKVAK
ETGYNMIHFTPLQKLGLSRSCYSLADQLEVNPEFSSPNKKCTWSDIGALVEKLKNEWNML
CITDVVYNHTATNSEWLRMHPECGYNLVNSPHLKPAWVLDRALWHLTCMVADGKCTAKGV
PPLIENDHHLNCIRKIIWEDIYPKIKLWEFFQVDVNKAVQQFKTLLTQGKISTKSDPNQH
LQIVQDPDYRRFGCTVDMNIALATFIPHSNGPAAIEECCNWFRKRIEELNAEQYRQTNHH
QEQAVNCLVGTVVYERLAGNGPKLGPISRKNPLVTRYFTYPFKELTVEEEETLIHQPDKA
CYFMAHNGWVMGDDPLRNFAEPGSNVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKY
TEITAKYFHGVRLDNCHSTPIHVAEYMLDTARKLRADLYVVAELFTGNEELDNIFVNRLG
ITSLIREAMTAYNSHEEGRLVYRFGGEPVGSFVQPRLRPLMPAIAHALFMDITHDNECPI
QHRSAYDALPSAMIVSMACCATGSTKGYDELVPHQISVVSEERFYAKWNPAAHLSSGEVN
FQTGILAGRLAINRLHQELGAKGFNQVYVDQVDEDIVAVTRHCPNTHQSVVAVSRTAFRD
PKTSFYSKEVPEMCIPGKIEEVVLEARTTERSASPYKKDQHFINGLPDFTVELREHIQIK
DSKIIKQAGTAIKGPNEFVQEIEFEKLTPGSVIVFRVSLDPKAQEAVGVLRNHLIQFSPH
FKCGSLPDDHSSPILKTLFSSIASKLTLADLNQVLYRCEAEEQEDGGGCYNIPNWSPLKY
AGLQGLMSVMADIRPKNDLGHPFCDNLRSGDWMIDYVSNRLISRAGACAEVGQWLKAMFV
YLKRIPRYLIPCYFDAILVGAYTTLLDVGWQQMSSFVQNGSTFVKHLSLGSVQMCGIGRY
SCLPDLSPSLHDVPYRLNEITNEKEQCCVSLAAGLPHFSSGIFRSWGRDTFIALRGLMLV
TGRYLEARNIILAFGGTLRHGLIPNLLGQGTHARYNCRDAVWWWLQCIQDYCKIVPNGLD
ILRCPVSRMYPRDDSSPQPAGTMDQPLYEVIQEAMQRHMEGINFRERNAGPQIDQNMRDE
GFNVTAGVDLETGFVFGGNRFNCGTWMDKMGESDRARNRGIPATPRDGSAVEIVGLCKSA
VRWLLDLSRKNVFPFCGVTVKRHGKEETITYDEWNRKIQGHFERLFFVSENPADPNEKHP
NLVHKRGIYKDSYGASSPWCDYQLRPNFTIAMVVAPELFTPERAWKALQIAEEKLLGPLG
MKTLDPDDMVYCGVYDNALDNDNYNVARGFNYHQGPEWLWPIGYFLRAKLYFSKLIGPEI
YAKTVVMIKNVLSRHYVHLERSSWKGLPELTNENGQYCPFSCETQAWSIGVILEILYDL
NT seq 4680 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccagtggtttgcacagagggctcgcttctccctccccgaagtgagtctcttg
gcgcgggcgggggggccgggagaaggccgcgggcccgccaaggagacgcggctgctgcac
ctcagtgagatggagaagctggataagaccctcttcaggctggagcaaggttttgaacta
cagttccgattgggcccgactcttcaaggcaagcctgttactgtgtacacaaattatcca
gcttctggagaagtatttgatcgccacaagttcaggacactatcgtggcacaatcctaca
ggaaaagaagatgactctgacaaatactgcaaactggatctccagatttctgggtcatac
cagtactatttcagtcttggaaatgaaaaaagtggtggaggttacatagttgtggatcct
attttacatgtcggagctgataatcatgtgttacctttggattgtgttacactccagacg
ttcctcgctaagtgtcttggaccatttcatgaatgggaagataggcttaaagttgcaaaa
gaaacaggttacaacatgattcattttacaccactgcagaagcttggactgtctagatca
tgttattcactggctgatcaattagaagtaaatcctgaattttcaagccctaataaaaag
tgcacttggagcgatataggagctcttgtggaaaaactgaaaaatgaatggaatatgctt
tgcatcacagatgtggtctacaatcatactgctactaacagtgaatggctcaggatgcat
ccagaatgtggttataaccttgtaaattctccacatctgaagccagcttgggtcttggat
agagctctgtggcacttgacctgtatggtggctgatggaaagtgtactgctaaaggggtc
cctcccttgattgaaaatgatcatcatctgaattgtatccgtaaaataatttgggaagat
atatatccaaaaattaaactatgggaatttttccaagtggatgttaacaaagccgtgcag
caatttaaaactcttctaactcaaggcaaaatcagcactaaatctgatccaaatcaacat
cttcaaatagttcaggaccctgattatagaagatttggctgtactgtagatatgaatata
gcactggcaacattcataccacacagcaatggaccagctgcaatagaagaatgttgtaac
tggtttcgcaagaggattgaggaactgaatgctgaacaatacagacaaactaatcaccat
caagagcaggctgtcaattgtcttgtggggactgtggtttatgaacgactggctggcaat
ggtcctaagctgggtcctatcagtagaaaaaaccctttagttaccaggtatttcacttat
ccattcaaagagctgactgtggaggaagaagaaactttgatacatcagccagataaagct
tgttatttcatggctcataatggctgggttatgggagatgatcctcttagaaactttgca
gaaccaggttcaaatgtttacttgagaagagagcttatttgttggggagacagtgtcaaa
ctgcgttatggtaataaacctgaagattgtccatacctctgggcacatatgaaaaaatac
actgaaatcactgccaaatatttccatggtgttcgtcttgacaactgtcactcaacacct
attcatgtagctgagtacatgctggacacagctagaaaattgcgagccgatttgtatgta
gtggctgaactgttcacaggaaatgaggagctggacaatatctttgtgaataggctgggc
attacctccttaataagagaggcaatgactgcttataatagccatgaagagggaaggtta
gtttatcgttttggaggtgaacctgttggctcttttgttcagccacgtttgaggcctttg
atgccagctattgctcatgcactgtttatggatattacacatgataatgaatgcccaatt
cagcaccggtctgcatatgatgctcttcctagtgcaatgattgtttccatggcatgctgt
gctacaggaagcaccaaaggctatgatgaactagtaccacaccagatctctgtagtatct
gaagagaggttttatgcaaaatggaatccagcagcacacctgtcttccggtgaagttaat
ttccaaacaggaattctagcaggaaggctggccataaacaggctgcatcaggagttgggg
gccaaaggctttaatcaggtgtatgtagatcaagttgatgaagatatagtggcagtgaca
agacattgccctaacacgcaccagtctgttgtggctgtaagtcgaactgccttcagggat
cctaaaacttccttctacagtaaagaagtacctgaaatgtgtatcccaggaaaaatagaa
gaagtagtacttgaagctagaactactgagagaagtgctagtccttacaaaaaagatcaa
cattttataaatggactgcctgatttcacagtagaactcagagagcatatccagatcaaa
gacagtaaaattataaagcaagctggaactgccataaaagggccaaatgaatttgttcaa
gaaatagaatttgaaaaattaacaccgggaagcgtaatagtattcagagttagtcttgac
ccaaaggcacaagaggctgttggtgtacttcgcaatcacttgatccagttcagccctcat
tttaaatgtggaagtcttcccgatgatcattcatcacctatactaaaaacgttattttct
tctattgcatctaaactaactttggctgacctaaatcaagtactgtatagatgtgaggca
gaagaacaagaagatggtggaggctgttacaatataccaaactggtcaccactgaagtat
gcaggcctccaggggttaatgtcagtgatggcagacattagaccaaagaatgatttgggt
catccattttgtgataacttaagatctggagactggatgattgattatgtcagtaatcgt
ctaatttcacgtgcaggagcctgtgcagaagttggtcaatggttgaaggccatgtttgtc
tacctgaagagaattccacgttacctcatcccatgttactttgatgccatattagtgggt
gcatacacaacacttctggatgtgggatggcaacagatgtctagctttgtgcagaatgga
tcaacatttgttaaacacctttccttgggttcagtccagatgtgtgggataggaagatat
tcttgtctgccagatctatctccttccttacatgatgttccctataggctgaatgagatt
acaaatgagaaagaacagtgttgtgtttccttggcagctggtttacctcacttttcttct
ggaatttttcgctcttggggaagggatacctttattgcactgagaggtctaatgttagtt
actgggcgctatctagaggcgagaaacatcattttagcatttggtgggactttaagacat
ggtctcattcccaatctgcttggccaggggacacatgccagatataattgccgtgatgct
gtatggtggtggcttcagtgtatccaggactactgtaaaattgttccaaatggattagac
attctcaggtgtcctgtttctaggatgtacccaagagatgactcttctcctcagcctgca
ggcactatggatcagccactttatgaagtgatacaggaagcaatgcagcgacatatggaa
ggcataaatttccgagaaaggaatgctggtccacagatagatcaaaacatgagagatgaa
ggttttaatgtaactgcaggtgttgatcttgaaactggatttgtctttggagggaaccgc
ttcaattgtggcacttggatggataaaatgggagagagtgacagagctcgcaacagagga
attccagctaccccaagagatggctctgctgtggaaattgttggcctgtgcaagtcggct
gttcgctggttgctggatttatcacggaaaaatgtgtttccattctgtggagtcactgta
aaaagacatggaaaggaggagactatcacatatgatgagtggaacagaaaaattcagggc
cactttgaaaggctgttctttgtctctgagaacccagcagatcctaatgagaaacatcca
aatctcgttcacaaacgtggaatttataaggacagttatggagcttcaagtccatggtgt
gattaccaactcaggccaaattttacaatagcaatggttgtggctccagagttgttcaca
cctgagagagcttggaaagctctgcagatagcagaggaaaagctgcttggtccgttaggc
atgaaaaccttagacccagatgatatggtttactgtggagtatatgataacgctcttgac
aatgacaactataatgtagccagaggttttaattatcaccaaggacctgaatggctgtgg
cctattggatattttcttcgtgccaagttgtatttctcaaagttgattggtccagagata
tatgcaaaaactgtagttatgattaagaatgttctttctcgccactatgttcaccttgaa
agatcatcctggaaaggacttccagaactgaccaatgaaaatggacagtattgtcctttt
agctgtgaaactcaggcctggtcaattggtgttatccttgaaatcctttatgacttgtaa

DBGET integrated database retrieval system