KEGG   Falco peregrinus (peregrine falcon): 101911819Help
Entry
101911819         CDS       T02856                                 

Gene name
SRD5A1
Definition
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101911819 (SRD5A1)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101911819 (SRD5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 188 aa AA seqDB search
MRQQNQHLGVKASITFELGSKTPLTIWALIFPLLIREGKPTPFFTFVLALLFCVYNGYLQ
GRSLSNYAKYPSGWLKDPCFITGFIGWLMGMAINIHSDHILRNLRKPGETGYKIPRGGMF
EYVSGANFFGEILEWFGFALACCTIESLAFALCTLFILGSRAKQHHQWYLEKFEDYPKGR
KIVIPFVY
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagcaaaatcaacatttaggtgttaaagcaagcataacctttgaactgggatca
aaaactccactgacaatttgggcactcatatttcctcttctgattcgggaaggaaaacca
acaccgtttttcacttttgtgctagcgcttctgttctgtgtttacaatggatacttgcaa
ggccgcagcttgagcaactacgcaaaatacccttcaggctggttaaaagatccatgtttc
atcacaggttttatagggtggctgatgggcatggcaatcaatattcattctgatcatatt
ctcagaaatctgagaaagccaggagaaactggttacaagataccaagaggaggaatgttt
gagtatgtcagtggagccaacttttttggagagatcctggaatggtttgggtttgccctt
gcttgctgcaccattgaaagccttgcatttgcactgtgtacacttttcatcttgggttca
agggcaaaacaacaccatcaatggtaccttgagaaatttgaagactacccaaagggccga
aaaattgtgatcccttttgtgtactga

DBGET integrated database retrieval system