KEGG   Falco peregrinus (peregrine falcon): 101912200Help
Entry
101912200         CDS       T02856                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101912200
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101912200
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101912200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 358 aa AA seqDB search
MGLSAGLAVVAQPCVPVSRQRSLLRQAEIPGEYWGWLAWYPQLHILLLHLLLIYISVPXL
ICLFPVLLTTFLYLNFLAFPFFVDFRWLELRLNNTISLYLTTKADTTVGIWLAVPSSRGA
EARGKDQRWYEEALADAHPVIIYLHGCEGTRAVSHCVQFLKTGAGGAADFHILAFDYRGY
GGSSRHPRESGFITDVLALCDWARAQSGNSSILFWGHSLGTGIATNVARKLQEEXGVQVD
AVVLESLYPSIREAAAHIPVSKIYRQFPGCEYFILDLLALRNMFFCSDKNVKVLTCPLLI
LHAEDDAVLPLHLGHKLFETAHSTYKDKTKVKFITFPKKLGLGHNYISFSLELPTLVK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgtcagcaggcctggcggtggtggcccagccatgtgtgcctgtgtccaggcag
cgcagcctcctgcgccaggcggagattcctggggaatactggggctggctggcctggtat
ccccagctgcacatcctcctcctgcacctgcttctcatctacatctctgtgcccntcctc
atctgcctcttccccgtcttgctcaccacatttctatacctgaacttcctggccttcccc
ttctttgtggactttcggtggctagagctgcggctgaacaacaccatcagcctgtacctc
accaccaaggcagataccacggttggcatctggctcgcggtgccaagcagcagaggggct
gaagcacggggcaaggaccagcgctggtatgaggaggcacttgctgatgctcaccctgtc
atcatctacctgcacggctgtgaggggaccagggctgtgagccactgtgtccagttcttg
aagacgggggcggggggggctgctgacttccacatcctggcttttgactacagaggctat
gggggctccagcaggcaccccagggagagtggcttcatcacggatgtcctggcactctgt
gactgggccagagcacaaagcgggaacagcagcatcctcttctggggacactccttgggg
acaggaattgccacaaatgtggcaaggaaactgcaggaggagtgaggggtccaagttgac
gctgttgtcctggagtcactgtaccccagcatccgcgaggcagctgcccacatccccgtc
agcaagatctaccgccagttcccaggttgtgagtacttcatcttggacttgttggctctg
cgcaacatgttcttctgcagtgacaagaatgtgaaggtgctgacctgcccgctcctcatc
ctgcatgcagaagatgatgctgtcctacctctgcacctgggccacaagctctttgagact
gctcacagcacctacaaggacaaaaccaaggtgaagttcattacctttcccaagaagcta
ggcctgggccacaactacatctcattcagcctggagctgcccaccctggtgaagtag

DBGET integrated database retrieval system