KEGG   Falco peregrinus (peregrine falcon): 101912487Help
Entry
101912487         CDS       T02856                                 

Gene name
ENTPD2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2
  KO
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101912487 (ENTPD2)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     101912487 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 462 aa AA seqDB search
MPTETCSACLLNSLGGTKLPTKHLPTEHHPTTHREQCCFLSAGPGISSYSSNPPAAGTSL
VHCLNQALRDVPKEKHAGTPLYLGATAGMRLLNITNPQASDTVLSAVAATLKSYPFSFRG
AKILSGEEEGVFGWVTANYLLENFIKRGWLGEWIQPQKKTLGAMDFGGASTQITFETRDT
IEDPRNEVMLKLYGQAYKVYTHSFLCYGRDQVLKRLLSKLLQAERYQATVSHPCWPTGYH
KSLLLSSVYDSPCTEKERPSFALNTTVTVVGTGNGSLCTLHVSKLFNFATCSFSRCSFDG
IFQPEVSGNFIAFSAFFYTVDFIQTVMGRPVRLPSDLKDAAETICATSWSELLQKAPKLE
KRLPDYCAVSTFVYLLMTKGYNFNNHSFPNIAFQKKAGETSIGWALGYMLNLTNMIPAET
PSSHKSMLYNYWVILILLFVVTTLTSLATAVCLLRRSKSSAI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagaaacctgcagtgcctgccttttgaacagcctgggagggacaaagctgccc
accaagcatcttcccactgagcatcatcccaccacccacagggagcaatgctgttttctc
tctgcaggtcctggcatctccagctacagctccaaccctccagctgctgggacgagcttg
gtgcactgcctgaaccaggctctgagagacgtgcccaaggagaagcatgcgggcacccca
ctctacctgggcgccacagccggcatgcgcctgctcaacattacaaacccgcaggcttcg
gacaccgtcctcagcgccgtggcagccacgctgaagtcgtaccccttcagtttccggggg
gcaaagatcctgtcgggggaagaggaaggggtctttggctgggtcaccgcaaactacctc
ctggagaacttcatcaagcgtgggtggcttggggaatggatccagccccagaagaagacc
ctgggggccatggactttgggggtgcttctacacagatcacctttgaaaccagggacacc
atcgaagaccccagaaacgaggtgatgctgaagctgtatggccaggcatacaaagtgtac
acgcacagcttcctctgctacggaagggaccaggttctcaagaggctgctctcaaagctc
ctccaggcagagaggtaccaagcaactgtctcccatccctgctggcccacaggctaccac
aagagcctgttgctgagcagcgtctacgacagcccctgcacagaaaaggagaggccgagc
tttgccctcaacaccactgtcaccgtggtcggcaccgggaatgggagcctctgcactctg
catgtcagcaagctcttcaacttcgccacctgctccttctcccgctgctcctttgatggc
attttccagccggaggtttcaggaaacttcatcgccttctctgccttcttctacacggtg
gacttcatccagacagtgatggggagacccgtgcgcttgcccagtgacctgaaggatgct
gctgagactatctgtgccaccagctggagtgagttgctccagaaagcccccaagctggag
aagaggctgccggattactgcgctgtcagcacatttgtttatttgctcatgaccaaaggc
tacaatttcaacaaccattccttccccaacattgccttccagaagaaggcaggagaaacc
tccatcggctgggcgctgggctacatgctgaacctcaccaacatgatcccagcagagacg
ccctcttcccacaaaagcatgctgtacaactactgggtcatcctcatcctgctctttgtg
gtcaccaccctgacatccctggcaactgctgtctgcctgctccggcgcagcaagtccagt
gcaatctaa

DBGET integrated database retrieval system