KEGG   Falco peregrinus (peregrine falcon): 101913246Help
Entry
101913246         CDS       T02856                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101913246 (CLOCK)
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101913246 (CLOCK)
Transcription factors [BR:fpg03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101913246 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 856 aa AA seqDB search
MFFTISTHKMSSIADRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGNIIYVSESVTPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLESGSL
TPEYLKSKNQLEFCCHMLRGTIDPKEQPTYEYVKFIGNFKCLNNVPNSAHNGFEGTIQRS
HRPSYEDKVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEITADKSQDSGSDNHINTVSLKEA
LERFDTSPTPSASSRSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQSLPGHEKTAQRRSSL
SSQSLSSQSLGQPVAQPAMSQPATLQLQSGMSQPVFQFSAQLGAMQHLKDQLEQRTRMIE
ANIHRQQEELRKIQEQLQIVHGQGLQMFLQQSASGLNFSSVQLASGSSSNVQQLTPINMQ
GQVVQSNQTQSGMNTGHISTPHMIQQQPLQSTATQHNQQNVLGGHNQQSSLASQSQNAVS
APLYNTMVISQPTTGNVVQVPSSVPQNNNQNAAAVTTFTQDRQIRFSQGQQLVTKLVTAP
VACGAVMVPSTMFMGQVVTAYPTFAAQQQQPQTLSITQQQQQQQSQQDHQQQLTTVQQPA
QPQLTQHPQQFLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQSQQQQQQQQQLP
RHRTDKMTDPSKGQPQ
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaccataagcactcataaaatgagctccattgcagacagaaatgatggaagc
atttttgatgggctggtggaagaagatgacaaagataaagcaaaaagagtgtctaggaac
aagtctgaaaagaaacgtcgagatcagttcaatgtacttatcaaagagctgggttccatg
cttccaggtaatgctcggaagatggataaatccactgtactgcagaagagcattgacttt
ttacggaagcacaaagaaattactgcacagtcagatgccagtgaaattcgacaggactgg
aagccgacattccttagtaatgaagagttcacacagttaatgttagaggctcttgatggt
ttttttttagcaattatgacagatggaaatataatatatgtgtctgaaagtgtaactccc
ttacttgaacatttgccatctgatcttgtggatcagagtgtatttaattttatcccagag
ggggaacattcagaaatttataaaatactgtcttctcatctgctggaaagtggttcattg
acaccagaatacttaaaatcgaaaaatcaactagaattctgttgccatatgctgcgagga
acaatagatccaaaagagcaacctacgtatgaatacgtaaaatttataggaaatttcaag
tgtttgaataacgttcccaactcagcgcacaatggttttgaaggaactattcagcgatct
caccgaccttcatacgaagacaaagtttgctttgtagccacagttagattagctacacct
caatttatcaaggaaatgtgcactgttgaagaacccaatgaagagttcacatctagacat
agcttagaatggaagttcctattcttggatcacagggcacctccaataataggttatctt
ccatttgaagttttgggaacatcaggctatgattattatcacgtggatgatctagataat
ctggcaaaatgtcacgaacatttaatgcaatatgggaaagggaagtcatgttactacaga
ttccttacaaagggacaacaatggatttggctgcaaacacattactatatcacgtatcac
cagtggaactccaggccagagtttattgtctgtacgcacactgttgtaagttatgcggaa
gttagagcagaaagacgacgagaacttggtattgaggagtctcttccagagattacagca
gataaaagtcaggactctgggtctgacaatcacataaacacagtgagtctcaaagaagca
ctggaaagatttgataccagccccacaccttctgcttcctccaggagttcaagaaaatct
tcacatactgcagtatcagatcattcatcaacaccaactaaaatgacggtggacactagc
actcctccaaggcaaagcttaccgggtcatgaaaagactgcacaaagaagatcatctctg
agtagccagtctttaagctcccagtctcttggacaaccagtagcacagccagcgatgtct
cagcctgcaactttacagctccagtcgggcatgtcccagcctgtgtttcagttttcagct
caattaggagctatgcagcacttaaaggaccagctagagcaaagaacacggatgatagag
gccaatattcatcggcagcaggaggagttgcgtaagattcaagagcagcttcaaattgtc
cacggtcaaggactccagatgttcttgcagcagtcggcttcaggactcaacttcagttca
gtgcagcttgcttctggaagttcttcaaatgttcagcagcttacaccaataaacatgcaa
ggtcaagttgttcagagtaatcagactcaaagtgggatgaacacaggccatataagtact
ccacacatgatacaacaacagcctttgcagagtactgcaacacagcataatcaacaaaat
gtacttggtggccataatcaacagtcttctcttgccagtcagtcacagaacgcagtctcg
gcgcctttgtataacactatggtgatttctcagcccacaacaggaaatgtggtccaggtt
ccttctagtgtaccacagaacaacaaccagaatgctgcagcagtaaccacttttacacag
gatagacaaatcagattttctcaaggtcagcaacttgtaacaaaacttgttacggcccca
gtagcatgtggagcagtaatggtaccaagtactatgtttatgggacaggtggtgacagct
tatcccacttttgctgcccaacagcagcagccacagactttgtcaataacacaacagcaa
cagcagcagcaaagtcagcaagaccatcagcagcagctcaccacagttcagcaaccagct
cagccacagctgacccagcacccccaacagtttctacagacatccaggttacttcatgga
aatcagtcagcgcagcttatcctctctgctgctttcccactacaacaaagcactttcact
cagtcccaccaccagcagcatcagtctcagcagcagcagcagcagcagcagcagcttccg
cggcacagaactgacaagatgactgatccttccaaaggtcagccacaatag

DBGET integrated database retrieval system