KEGG   Falco peregrinus (peregrine falcon): 101913413Help
Entry
101913413         CDS       T02856                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101913413
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101913413
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101913413
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101913413
  Exosomal proteins of breast milk
   101913413
Heparan sulfate/heparin binding proteins [BR:fpg00536]
 Enzymes (General comment) Variety
  101913413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 484 aa AA seqDB search
MRPYSYKSTSSVYVIATVCQFAEAETSFEGIESKFSLRMPAEPDEDVCYLVPGQVDSLAQ
CNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLIRAQQHYPVSAA
YTKLVGKDVAMFIDWMEEQFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAG
PTFEYADALIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLG
EALRLIAEKGFADVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKGLCLSCR
KNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNTTKTNQPFLISL
YGTLDESENIAFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSDWWTPFTF
DIQRVRVKSGETQKKVVFCSRDGTSHLSKGEEAAIFVKCLEQPINKKREGAKKASKENSA
HESA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagaccttattcgtacaaaagcactagcagcgtctacgtcatcgctacagtttgccag
ttcgcagaagccgagaccagttttgagggaattgagagcaagttctccttacggatgcct
gcagagcccgatgaggatgtctgctacctggttcctgggcaggtggacagcctggcacag
tgcaacttcaaccataccagtaaaacctttgtggtgatccatgggtggacggtgacagga
atgtatgaaagttgggtcccgaagctggtggatgctctgtacaagagagaacccgattca
aacgtcattgtggtggactggctaattcgagctcagcagcactacccagtgtccgctgca
tacactaagctggtgggaaaggatgttgctatgtttattgactggatggaggagcaattc
aattatcctctcaacaatgtccacttgctggggtacagtctaggtgcacatgctgctggg
attgctgggagcctgaccaagaagaaggtgaacagaattactgggctggatccagctggt
cctacctttgaatatgccgatgccctcatccgcctctcaccagatgatgctgactttgta
gatgttctacacacttacactcgaggctctccagaccgcagcattgggatccagaagcct
gttggacacattgatatttatcctaatggtggaggtttccagccaggttgcaacttagga
gaagcactccgtctgatcgctgaaaaaggctttgcagatgtggaccagctggtaaaatgc
tcccatgaacgatccatccaccttttcattgactccctcctctatgaagaaaagcccagc
atggcctaccgctgcaacacaaaggaggcctttgagaagggtctctgcctcagctgtcgg
aagaaccgctgcaataatttgggttacaaggtcaacagagtgagaacaaagagaaacacc
aaaatgtacttgaagacccgtgctcagatgccttataaagtctttcattaccaggtcaag
atccatttctttggaaagactaatacgaccaagacaaaccagccattcctgatctctctc
tatggcactctagatgagagtgagaacattgctttcacactgcctgaagtctcctcaaac
aagaccttctccttcctgatttacacagaggtggacattggtgacctgcttatgctgaaa
ctgcagtgggagaaagacactttcttcagctggtcagactggtggactccttttacattt
gacatccagagagtcagagtgaaatcaggagaaactcagaaaaaggtggtgttctgttct
cgagatggaacctcacatctcagtaagggagaagaagcagcaatattcgtgaaatgcttg
gagcagcccatcaacaagaagagagaaggagccaagaaagcctctaaagaaaattctgct
catgaatctgcttaa

DBGET integrated database retrieval system