KEGG   Falco peregrinus (peregrine falcon): 101914245Help
Entry
101914245         CDS       T02856                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101914245 (POMT2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     101914245 (POMT2)
Glycosyltransferases [BR:fpg01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101914245 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 665 aa AA seqDB search
MGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFPFQKPGDRYEQHNYVGMRGFCAFL
GSCLVPFAYLTVLELSKSLPAALLTAFILIFDTGCITLSQYILLDPILMFFLMGAVLSMV
KCNGCANRPFSASWWFWLSLTGVNLAGAMGVKFVGLFVVLLVGLNTIYDLWDLLGNLSLS
LVMFGKHLLARVLCLILLPLALYTAMFAVHFTVLNKSGPGDGFFSSAFQSQLIGNNLHNV
SVPEHLAYGSVVTMKNLRMAGGYLHSHWHLYPEGIGARQQQVTAYLHKDLNNLWIIKKPD
LDTVCLLSADLSDPSSPVEFVRHGDIIRLEHKETSRNLHSHQHEAPLTRKHFQVTGYGIN
GTGDSNDFWRIEVVGRKAGKLIKVLRSQVRLIHVATGCILGSSGKTLPKWGWEQVEVTCT
PYLKETPNSLWNFEDHINPKLPNISLDVLKPSFAEILLESHMVMIRGNSGLKPKDNEVTS
KPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNLVTIGLYLLITVSTAVALKRGVQL
TSELKELSRVMLHGGGQIALGWLLHYLPFFMMGRVLYFHHYFPAMLFSSMLTGITWDALL
KFCAGFLLPSTTARKVYGGGFLALVLLIMYSFYLFHPLSYGMIGPMASDPSSPMAGLRWM
DSWEF
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttactacattaatcggaccttcttctttgatgtccacccccctctggggaag
atgctgattggacttgctggctaccttagtggatatgatggcacatttcctttccaaaag
ccaggagacagatatgagcagcacaactacgtgggaatgagagggttctgtgcgttcctt
ggttcctgcctggttcccttcgcctacctcacagtgctggaactgtcaaagtcactgcca
gcagcattactcacagctttcatccttatttttgatacaggatgtattactttgtcccaa
tatattctactggatcccattctcatgttcttcctcatgggagctgttctgagtatggtg
aaatgcaacggctgtgcgaataggccattttctgcttcctggtggttctggctgagtctg
actggcgtgaaccttgctggggcaatgggcgtaaagtttgttggcctttttgtagtcctc
ttggttggcctgaacacaatctatgacctatgggacttgctggggaacctcagcctgtca
ctggtcatgtttgggaagcatttactggctcgtgtactctgcctcatcctgctcccgctt
gccctctacacggctatgtttgctgttcattttacagtattaaataaaagtggtcctggg
gatggtttcttcagctcagcatttcagtcccagctgattgggaacaatcttcataatgtc
tctgttccagagcacttggcgtatgggtctgttgtcacaatgaagaaccttcggatggca
ggaggataccttcactcccactggcacctctacccggagggcattggggctcgccagcag
caggtcactgcctacttgcataaagatttgaataacctgtggattataaagaaacctgat
ttggatacagtttgccttctttctgcagatctgtcagacccctcgagccctgtggaattt
gtgaggcacggagatattattcgtctggaacataaagaaacttctagaaatcttcacagt
caccagcatgaggctcccctgacgaggaagcatttccaggtcactggctatggaataaat
ggaacaggagactccaatgacttctggcggatcgaagtggtaggcagaaaggctgggaag
ctcatcaaagtcctacggagtcaggtccggctaatccatgtggccacagggtgtatactg
ggctcttctggaaagactctgccaaaatggggttgggaacaagtggaagtcacctgcaca
ccatacctgaaggagacccccaattccctctggaactttgaagatcacattaaccctaag
ttgcccaatatcagcctggatgttttaaaaccctcttttgcagaaattctgctagaatcc
cacatggttatgattcggggaaacagcggcctcaaaccaaaggacaatgaagttacatcc
aaaccttggcactggcccatcaactaccagggcctgcgtttttctggtgtcaatgagacc
gattatcgggtttatttgctggggaacccggtgatttggtggctaaatctggtcactatt
gggttatatcttctgataacagtttccactgcagtggccctgaagagaggtgtccaactg
acatctgaactcaaagaactgtccagagtcatgctacatggtggagggcagatcgcgctg
ggctggctccttcattacctccctttttttatgatgggacgagttctctactttcaccac
tactttcctgccatgcttttttccagcatgttgacaggaatcacctgggacgctctactg
aagttctgtgctggattcctgttacctagcactacagctagaaaagtgtatggagggggg
ttcctggcactggttctgctcatcatgtacagcttctacctcttccatcctctgtcctac
gggatgataggacccatggcctctgaccctagcagccccatggcagggctccggtggatg
gactcctgggagttctag

DBGET integrated database retrieval system