KEGG   Falco peregrinus (peregrine falcon): 101914814Help
Entry
101914814         CDS       T02856                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
fpg  Falco peregrinus (peregrine falcon)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 734 aa AA seqDB search
MSETMSTNEKKPPLNGRRALPSNNSNDEENEVPEMEAFGLIPRGFNPRDYLRVVDIHMFK
DPHEINKQQHHTDRYYSPKLIVRRGQPFQIQIDFNRPYNPETDQFWLEYLIGRYPQQNKG
TYIPILVGDVLRPGEWGAKITYRENNSIRLSIMSSATCVVGKFRLYIAVWTPFGILRTHR
NAETDTYILFNPWCQQDAVYLDDEKEREEYVLNDVGIIFHGNINDIKFRSWSYGQFEENV
LDACLFLMDKAELELSGRGNPIKICRVASAVINSRDDNGVIAGSWDNTYTYGVPPSAWTG
SVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLQLDFFL
DDEGKLDTKITKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDGTPQETSDGMYRCGPASV
QAIKHGHVCFQFDAPFVYAEVNSDIVYSRREKNGIQVIEKIDTTHIGQLIVTKEVGGDGM
MEITEEYKFQEGSEEERLALETAVMYGIKKQATQDTTYQPQTDVDMEFQVQKAILGSDFK
VTIIFRNKSRNQYTATTYLSGNIVFYTGVTKNEFKKYSFSAKLEPSSSSAFDVVIKSSEY
LSDLLDQASFHFFVTARINETGKILAMQKATVLEIPTLRIKTQGELVAGKEMSVTVEFTN
PLKQILENVTLRLEGPGILRTMKKEFRKIYPTSTLIWDVKCIPKKPGLRKLIASLNCDAL
RHVYGELNVQIQKP
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaatgagcaccaacgagaagaaacctcctctgaatggaaggagagccctc
ccatcaaacaactctaatgatgaagaaaatgaggtccccgagatggaggcttttggattg
atacctagaggatttaatccaagagattacttgcgtgttgtggacattcatatgttcaag
gacccccatgagatcaacaagcagcagcaccacaccgacaggtactacagccccaagctg
atagtgcgccggggacagcctttccaaatccagattgacttcaaccgaccctacaaccca
gagacggaccaattctggctggagtatttgataggtcgctacccacagcaaaacaaaggc
acctacatcccaatactagtaggtgatgtgctaagacccggtgagtggggagccaagatt
acctacagggagaacaactccattcgcctgtccatcatgtcctctgccacctgcgtcgtt
gggaagtttcgcctgtacattgctgtctggactccctttggcatcctccggacacacaga
aatgcagaaaccgacacttacatcctgttcaatccctggtgccagcaggatgctgtgtat
ctggatgacgagaaggaaagggaagaatacgtcctgaatgatgttggtatcattttccat
ggaaacatcaacgatataaaatttagaagctggagttatggtcagtttgaagaaaacgtt
ctggatgcttgcctgttcctgatggacaaggcagaactggagctctctgggcgtggaaac
cctatcaaaatctgccgtgttgcctctgcagtgatcaactccagagatgataatggtgtg
attgctggatcctgggacaatacatacacttacggtgtcccaccttcagcctggacggga
agtgtggacattctcttggagtattacagttctaagcaacccgtgcgatacggccagtgc
tgggtctttgctggtgtcttcaacacatttctgaggtgcttggggatacctgcaagactc
attaccaactattcttctgcccatgataacaatgccaatttacagttggatttctttctg
gatgacgaagggaaattggataccaaaattacaaaagactctgtctggaactaccactgc
tggaatgaagcttggatgaccagaccggatcttcctgttggttttgggggatggcaggtt
gttgatgggacaccccaagaaaccagtgatggtatgtacaggtgtggaccagcctcagtt
caagccattaaacatggtcacgtttgcttccaatttgacgcgccttttgtctatgctgag
gtgaatagtgatattgtttactcaagaagggagaaaaatggaatccaagtgatagaaaaa
attgacacgacccatattgggcagttgattgtgaccaaggaagttggaggtgatggaatg
atggagattactgaggagtacaagttccaagaaggctcagaggaggagagactggctctt
gagactgctgtgatgtatggcattaaaaagcaagctacccaagataccacgtatcagcca
caaacggatgtggacatggaattccaagtgcaaaaggcaatccttggcagtgactttaaa
gtcactataatattcaggaacaaaagtcgcaaccagtacactgctactacctacctttca
ggcaacatagtgttttatacaggagtcacaaaaaatgaattcaagaaatactccttcagt
gcaaaactggagccctcttcatctagcgcttttgatgttgtgatcaaatcgagtgaatac
ctgagtgacttgctggaccaagcctcctttcatttctttgtgacggcacggatcaatgaa
acagggaagattctggccatgcagaaggcgacagtcctggaaattcccaccctgcggatc
aagacccaaggtgagctggtagctggtaaagaaatgtctgtgactgtagaattcaccaat
cctctgaaacaaatcctggagaacgtcactctccgcctcgagggacctggcatactgaga
acgatgaaaaaggagttcagaaagatttatcctacatctaccttgatctgggatgtaaaa
tgcatcccaaagaaaccaggattacgaaagctgattgcaagcctaaattgtgatgctttg
aggcatgtgtatggtgagctgaatgttcagattcagaagccgtga

DBGET integrated database retrieval system