KEGG   Falco peregrinus (peregrine falcon): 101915314Help
Entry
101915314         CDS       T02856                                 

Gene name
KAT6A
Definition
(RefSeq) K(lysine) acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101915314 (KAT6A)
Chromosome [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101915314 (KAT6A)
   HAT complexes
    MOZ/MORF complex
     101915314 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 2018 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDGKPNVDWNKLIKRAIEGLAESSGSSLKN
IERFLKGQKDVSASFGGSTASIFHQQLRLAVKRAVGHGRLLKDGPLYQLNTKATTNADGK
ESFESLSCLPPVCLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTR
MPKGMWICQICRPRKKGRKLLHKKAAQIKRRYANPIGRPKNRLKNQNTTSKGPFSKVRTG
PGRGRKRKIALSSQSATSEGGYLEQTDVLDFCRDGSTTLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSQQYRIRKKGTRKSSTSEWPTGKDFSPCQYNQDGWDGKQENEERFFGS
QDVLTEKDMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIQTWYSSPYPQEYSR
LPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNL
CLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQY
QRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQRDKQLSI
KKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQEHMAKLRTNVRPIDVDAEC
LRWTPIIVSNSVVSEDEEEETEDGENEEQQQQKEKDPDASMVKSVSWEKKEQEPYSPTES
EKKPDIVAPANSAWPNKHIFPLDSLPANSQPSRRGRWNRKSKKLREPFCEKEPVLPVEDK
TAVPSGRCSECEEKSTASRGRCSDCEEKSVALQGRCGECEEKSPAPRGRYAEDEEKSAVS
QGQYGKGEKSAIPHRRYSEGMERWRGQLKKNTESLKCRFPEDCNRLPRRYSDSDRALLRC
FSESSEEEDDEPVSPRSSSPPVLTKPTLKRKKPILHRKRRVRKRKHHNSSVVTETISETT
EVLDEPFEDSDSERPMPRLEPTFEIEEEEEEDDDEEEENELLPSGYFRHLAPPDTLRHRP
SSKRKSKDEEESDDTNGNPTLKPLSMLRKCEAKDSSLELDTSTPMKKKKGWPKGKSRKPV
HWKKRPGRKPGFKLNQEKVPPSVQDEGVDAVGASSKPGRKPKISDKEESAEQKEELPLIE
ERKEDDVNMEAEEVGEGEEEDTASSEVRAVSPVDSNSSPVPEVKEPEIEEEVEEKPRVLE
EQRQSEEEQQELDEPEHDHEEEEEVAVVTNQNEDHDADDEDDGHLESVKKKESEEQPVRE
GVKEEPQVQECFLEASIPSSREDAKEKDEAEADSEEEQASNETSVGSEHIPGSEDDHEEE
QSNKEGLIELKEEEEIPHSELDLETVQAVQSLTQEESNEHDVAYQDCEETLAACQTLQSY
TQTEEDPQISMVEDCQASEHNSPISSVQSHPSQSVRSVSSPNVPALESSYTQISPEQGSL
SAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICG
NNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANIGSSCSMMQQNTVQPAANCNIKSPQSCV
VERPPSNQQPTTQPQQQQPQSQQPQPPPPPQQQPPLSQCSMSNSFTPAPMIMEIPESGST
GNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSL
SNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQ
GQMPVKGHISIRSKSAPLPSATAHQQQLYGRSPPAVAMQAGPRTLAVQRGMNMGVNLMPT
TPYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQ
PMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6057 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactagccaacccgctgtatacagagtggattttggaggcaatcaaaaaggta
aagaagcaaaaacagcgtccttctgaggagaggatatgcaatgcagtgtcatcttcacac
ggtttggaccgtaaaactgttctggaacagttagagttgagtgttaaagatggaactatt
ttaaaagtctccaacaagggtctcaactcctataaggatcctgataatcctgggagaata
gcacttccgaagcctcggaaccatggcaagttggatggtaaaccaaacgtggactggaat
aaacttatcaaacgggcaattgagggcttggctgagtctagcggctcatccttgaagaac
atcgagcgctttctgaaaggtcagaaagatgtgtctgcatcatttggaggtagcactgcc
tccatttttcaccagcaactacgattagctgtcaaacgtgctgttggccatggcaggctc
cttaaagatggacctctgtaccaactcaacactaaagcaaccactaatgctgatgggaag
gaaagttttgagtctctttcctgtctccctccagtgtgtctccttccccatgaaaaggat
aagccggttgctgaacctattccaatctgcagtttctgccttggtacaaaagagcaaaat
cgagagaagaaacctgaagagctcatttcttgtgctgactgtggcaacagtggtcatccg
tcctgtttgaagttctctccagagttgacagttcgagtgaaagccttgcgatggcagtgt
attgagtgcaaaacatgcagttcctgtcgagatcagggcaaaaatgctgataacatgctg
ttttgtgactcatgtgaccgtggctttcacatggagtgctgtgacccccctcttaccagg
atgccaaaaggtatgtggatatgtcaaatatgtcggccacggaagaaaggaagaaaactt
ttacacaagaaggcagcacagataaaacgacgctatgctaacccaataggacgtccaaaa
aacaggttaaagaatcaaaatacaacctcaaaaggccctttcagcaaagtccgaactggc
cctggtcggggtcggaagcgtaagattgctctgtccagccagtcagcaacatcagaagga
ggatacctggagcagacagacgtcttggacttctgcagagatggcagcaccaccttaaag
tttaacaagaaaaccaaagggcttatagatggccttactaaattcttcactccctcccct
gatggacgaaaagctcgaggggaagtagtagactattctcagcagtacaggatcaggaaa
aagggtaccaggaaatctagcacttcagaatggcccacaggtaaagatttttcaccctgc
caatacaatcaggacggatgggatggaaaacaggaaaatgaggagcgtttttttggaagc
caggatgtcttaactgaaaaagacatggagttgtttagagatattcaggaacaagcactg
cagaaagtaggggtgactgggcctcctgatccacaagtccgatgcccttctgtcatcgaa
tttggcaagtatgaaatccagacctggtactcctccccatatccacaggaatactcaagg
ctacccaagttgtacctttgtgaattctgtctaaagtatatgaaaagcagaactattctc
caacagcatatgaaaaagtgtggctggtttcatcctccagccaatgaaatttacagaaaa
aacaatatttcagtctttgaggttgatggcaatgtcagcacaatatactgccagaatttg
tgcttgttagccaaactcttcctggaccataagacactctattacgatgtggagccattt
cttttctacgtgctgacacagaatgatgtcaagggctgtcacctcgttggctacttttct
aaggaaaaacactgccaacagaagtacaatgtttcctgtataatgattcttccacagtac
cagcgtaagggctatggcaggttcctaattgacttcagctatttgctttcaaagcgtgag
ggtcaagcaggatcaccagagaagcccctgtcagacctggggcgcctctcatatatggct
tattggaaaagtgtaatattggagtgcctttatcatcagcgtgacaagcaattaagcatc
aagaaattgagtaagctgactggaatctgccctcaagatatcacttccactctacatcac
ctacgaatgcttgacttccgtagtgatcagtttgtgatcattcgtcgggagaaacttatc
caggagcatatggcaaagcttagaactaatgtccgacctatagatgtggatgcagaatgc
ctacgttggacacctattatagtttccaactcggttgtctctgaagatgaagaagaggag
acagaggatggggaaaatgaagagcaacaacagcagaaagaaaaggatccagatgccagc
atggtaaaatctgtgtcgtgggagaagaaagagcaagagccttactcacctacagagagt
gaaaaaaagccagacattgttgctccagccaattctgcatggccaaacaagcacattttt
cctctggatagtcttcctgcaaacagtcagccatcacgaagaggtcggtggaaccgtaag
agcaaaaaacttcgggagccattttgtgagaaggagccagtattgcccgttgaggacaaa
acagcagttcccagcgggcgatgcagtgaatgtgaggagaaatccacagcctcacgaggt
cggtgcagtgactgtgaggagaagtcggtggccttgcaaggaaggtgtggtgaatgtgag
gagaagtctccagccccaagaggccggtatgctgaagatgaggaaaaatctgcagtttcc
cagggacagtatggcaaaggtgaaaaatctgcaattccccatcggcggtacagtgaaggt
atggaaaggtggagagggcagttgaaaaagaacacggagtccctgaagtgtagattccca
gaggactgcaacagattaccccgccgctacagtgacagtgatagggcacttctgaggtgt
tttagtgagagtagtgaagaggaagatgatgagcctgtgagtcctcgatccagctctcca
cctgttctcaccaagccaacattaaaacgaaagaaaccaatccttcatcggaagaggcga
gtccgcaaacgcaagcaccacaacagcagtgttgtcactgaaacaatctcagagaccaca
gaagtgctggatgaaccgtttgaggactcagactctgaacgaccaatgccccgattggag
cctacattcgagattgaggaggaggaagaggaggatgacgacgaagaggaggagaatgaa
cttttgcccagtggatactttcggcacttagccccaccagacacactcaggcatagaccc
tcttctaagaggaagtccaaagatgaggaggagtctgatgacactaatggtaacccaact
ttgaaaccattgtctatgctgagaaaatgtgaagcaaaggattcttcacttgagctagat
acttctacacccatgaaaaagaagaagggatggccaaaagggaaaagccgaaagccggtc
cactggaagaaaagacctggccgaaaaccaggttttaaactgaaccaggaaaaggtacca
ccatcagttcaggatgaaggagttgatgctgtgggagctagttcaaaaccagggcgtaag
cccaaaatttcagataaagaagaaagtgctgagcagaaagaagagctgcctcttattgag
gaaaggaaagaagatgatgtgaatatggaagcagaagaggtaggagagggagaagaggaa
gatacagccagcagtgaagtaagggcagtttctcctgtggacagcaacagcagtccagtg
ccagaagtaaaagagcctgagatagaagaggaagtagaggagaagccacgggttttagaa
gagcagaggcaatcagaagaagaacagcaagaactagatgaacctgagcatgaccatgag
gaagaagaggaagtagctgtagtgacaaatcaaaatgaagatcatgatgctgatgacgaa
gatgacggtcatctggagtcagtgaagaagaaagaatcggaggaacagccagttagagaa
ggggtaaaggaggagcctcaggtgcaagaatgttttttagaagcaagcataccaagcagt
agagaagatgcaaaagaaaaagatgaagcagaggcagattctgaggaagagcaggcgtcc
aatgagacatcagttggctcagagcacatccctgggtctgaagatgatcacgaagaagag
caaagtaataaagaagggttaattgaattaaaggaagaggaagaaattcctcatagtgaa
ctagatcttgaaactgttcaagcagtccagtccttgacacaggaggaaagcaatgagcat
gatgtagcttaccaggactgtgaagaaactcttgcagcttgtcagactttgcagagttat
acccagactgaggaggatcctcagatatcaatggttgaagattgccaggcctcagaacac
aacagtccaatatcctctgtgcagtcccaccccagccagtctgtacgttctgtcagcagc
ccaaatgtgcctgctttggagagcagttacacccagataagtcctgaacaaggatccctg
tccgcaccctctatgcagaacatggagaccagccccatgatggatgtgccttcagtatca
gaccactctcagcaggtggtggatagtggcttcagtgaccttggcagcattgagagcact
acagagaattatgaaaaccccagcagctatgattccactatgggaggcagcatttgtgga
aataactcttcccagagcagctgttcatatggaggactatcctcttctagcagcctcact
cagaacagttgtgttgtcactcagcaaatggcaaacattggcagcagttgcagcatgatg
cagcaaaacactgtccagcctgcagcaaactgcaatatcaagtcacctcagagctgtgta
gtagaaaggcctccaagtaaccagcaaccaacaacgcagccacaacagcaacagcctcag
tcacagcagccacagcccccacctccaccccagcagcaacctccactgtctcagtgtagc
atgagtaacagcttcaccccagcacctatgatcatggaaatacctgaatcaggaagcact
ggtaacataagtatctatgagaggattccaggggattttggtgctgggagctattcacaa
ccatcagccacgttcagtttagccaagttgcagcagctgacaaacaccattatggaccct
catgccatgccttatagccattctcctgctgtgacttcctatgcaaccagcgtttctctg
tccaacacaggattggctcagctagctccctctcacccgttagcaggcacaccgcaagca
caagccactatgacacccccaccaaatctggcgtccaccaccatgaacctcacatcacct
ctgcttcagtgtaatatgtctgctaccaatattggtattccacatacgcagaggctgcag
gggcaaatgccagtcaaggggcacatttccattcgctctaaatcagcaccattgccctct
gcaactgcacaccagcagcagctctatggccgcagcccacctgcagttgccatgcaggct
ggtcctcgtacattagctgttcagcggggtatgaacatgggagtcaacctaatgccaacc
accccttacaatgtcaattccatgaatatgaacaccctgaatgccatgaacagctacagg
atgacacagcctatgatgaacagcagttaccatagtaaccctgcctacatgaaccagaca
gcacagtatcctatgcagatgcagatgggaatgatggggagccaggcctatacccagcag
cctatgcagccaaatcctcatggaaacatgatgtacactggcccctcccatcacagctac
atgaatgctgctggggtgcccaagcagtctctcaatggaccatacatgagaagatga

DBGET integrated database retrieval system