KEGG   Falco peregrinus (peregrine falcon): 101916407Help
Entry
101916407         CDS       T02856                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101916407 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    101916407 (COMT)
Enzymes [BR:fpg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     101916407 (COMT)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101916407 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 261 aa AA seqDB search
MLESFSVLLFVFILLFILLLFLVLIRKNGTAALIWNEIIREKITNFIMNQSKEQRILNFV
LQNAVRGDPCSVLDTIDKYCSQKEWAMNVGDEKGLILDKTLEEVNPSVALELGTYCGYSA
VRIARLLKPGARLLTVEFNPEFAAIAKQMIEFAGVQDKVKLLEGPSEEIIPQLKKKYEVD
TLDFVFLDHWKDRYTPDTILLQECNLLKKGSVLLADNIIVPGAPEFINYIRNNPHFQCTN
YPSHLEYMKVVDAMEKAVFLG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagcttttcagtccttttgttcgtcttcattctgcttttcattttgctgctc
tttctggtgctcatcaggaagaacggcactgctgcccttatctggaatgaaataatccgg
gagaaaataaccaatttcatcatgaatcagagcaaagaacagaggattttaaattttgtg
ctgcagaatgcagtccgaggagatccctgtagtgtgctggacactatagataagtactgc
tcccagaaagaatgggccatgaatgtgggtgatgagaaaggtttaattctagacaagaca
ctggaagaggtcaatccatcagttgcactggagctaggaacatactgtggctactcagca
gttaggattgctcggctactgaagccaggagctcgtcttctcactgtggaattcaaccca
gaatttgctgctatagctaaacagatgattgagtttgctggagtacaagacaaggtaaaa
ctcctagaaggtccttcagaggaaattatcccccagctgaagaaaaaatacgaagtagat
actctggattttgtcttcctggaccactggaaagacagatacacaccagataccatcctg
ctccaggaatgcaacttgctgaagaagggctcggttcttctggctgacaatatcatcgtc
ccaggagctccagaattcattaattatatccgcaacaacccccatttccaatgcactaat
tacccatctcatttggaatatatgaaagtggtggatgctatggaaaaggctgtgtttttg
ggataa

DBGET integrated database retrieval system