KEGG   Falco peregrinus (peregrine falcon): 101916829Help
Entry
101916829         CDS       T02856                                 

Gene name
KYNU
Definition
kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:fpg00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 474 aa AA seqDB search
MDPCSSVLPATVLEQIALRLGCSPTDKKLAFRLDEEDELKHLRECFCIPKVKDLPPTDLS
LVNGEESCIYFAGNSLGLQPRKVKTYLDEELDKWARTGVHGHFNGQRPWALADECILDLM
AELVGAQRQELALMNGLTVNLHLQLLSFFKPTPRRYKILLEAKAFPSDHYAVESQLRLHG
LDVEQCMLLVQPREGEETLRIEDILAVIEKEGDSIAVILFSGVQYYTGQLFDIPRITKAG
HEKGCFVGFDLAHAVGNVELHLHDWGVDFACWCSYKYLNSGAGGLAGAYIHEKHSQTIKP
TLIGWWGHDFKTRFLMENKLQLSEGINGFRLSNPPILLVCALQASLEVFGETTMKALRRK
SVLLTGYLEYLIRHYYSEDKTNPEKPFIKIVTPSQIEERGCQLTLSFSLPIKSVFQELEK
RGVACDIREPNALRVAPVPLYNSFHDVHRFIEILGSAITSSKQTANNTVLSGSY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggatccatgttcttctgtgttaccagcaactgttttagagcaaattgccttgcggctg
ggctgcagtcccacagacaagaaacttgctttccgcttagatgaagaagatgaattaaag
catcttcgtgaatgtttctgtatccccaaagtcaaggatctgcctccaactgatctgagc
ctggtgaacggagaggagagctgtatatactttgctgggaattctctcgggctccagcca
agaaaagttaaaacttacttggatgaagaactggacaagtgggctcgaacaggtgttcat
ggccatttcaatggtcagcgcccatgggctttggcagacgagtgcatcctagacctgatg
gctgagctggttggggcccaaagacaggaactagccttaatgaatgggctaactgttaac
ttgcacctccagttgttatctttctttaagcctactccaagacgctataaaattcttcta
gaagccaaagccttcccctctgaccattacgctgttgagtcccagcttcgccttcacggg
ctggatgtggagcagtgcatgcttttggtgcagccgcgggagggggaggagaccttgaga
attgaagatatccttgctgtaattgagaaggaaggggactcgatcgctgtcattctgttc
agtggggtgcagtactacacggggcaattgtttgatatccctagaataacaaaggctggc
catgaaaagggttgctttgttggatttgacctggctcacgctgttgggaatgtagagctt
catttgcatgactggggagtagattttgcgtgctggtgttcctacaagtatttaaattct
ggagcaggaggccttgctggtgcctacattcatgagaagcattcccagactattaaacct
acgctgattggctggtggggtcatgacttcaaaacacgattcctcatggaaaacaaattg
caactaagtgaaggaattaatggatttcggttatcaaatcctccaattttactggtctgt
gctctgcaagccagtttagaggtttttggtgaaactacaatgaaagcattgagaaggaaa
tctgttctactcacgggttacttggaatacctgatcagacattactacagtgaggataag
acaaatccagagaaacccttcataaaaatagtcacaccatcgcagattgaggaaagagga
tgccagctcactctatctttttcccttccaatcaaatctgtgtttcaagagctggagaag
agaggagtagcttgtgacatacgagaaccaaatgctcttcgtgttgccccagttcctctc
tacaattctttccatgatgtgcacagatttattgaaatcctgggatctgcaattacatct
tcaaaacaaacagcaaataatactgtgctatctggttcttattga

DBGET integrated database retrieval system