KEGG   Falco peregrinus (peregrine falcon): 101916829Help
Entry
101916829         CDS       T02856                                 

Gene name
KYNU
Definition
(RefSeq) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    101916829 (KYNU)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     101916829 (KYNU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 515 aa AA seqDB search
MAANCRVTWFHCGGEKMSLICKITFNTVTLLDTKVKLHDLKMDPCSSVLPATVLEQIALR
LGCSPTDKKLAFRLDEEDELKHLRECFCIPKVKDLPPTDLSLVNGEESCIYFAGNSLGLQ
PRKVKTYLDEELDKWARTGVHGHFNGQRPWALADECILDLMAELVGAQRQELALMNGLTV
NLHLQLLSFFKPTPRRYKILLEAKAFPSDHYAVESQLRLHGLDVEQCMLLVQPREGEETL
RIEDILAVIEKEGDSIAVILFSGVQYYTGQLFDIPRITKAGHEKGCFVGFDLAHAVGNVE
LHLHDWGVDFACWCSYKYLNSGAGGLAGAYIHEKHSQTIKPTLIGWWGHDFKTRFLMENK
LQLSEGINGFRLSNPPILLVCALQASLEVFGETTMKALRRKSVLLTGYLEYLIRHYYSED
KTNPEKPFIKIVTPSQIEERGCQLTLSFSLPIKSVFQELEKRGVACDIREPNALRVAPVP
LYNSFHDVHRFIEILGSAITSSKQTANNTVLSGSY
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaactgccgggtgacgtggtttcactgtggaggggaaaagatgagtctgata
tgtaaaattacttttaacaccgtaacacttcttgacacgaaggtgaaactgcatgacctg
aaaatggatccatgttcttctgtgttaccagcaactgttttagagcaaattgccttgcgg
ctgggctgcagtcccacagacaagaaacttgctttccgcttagatgaagaagatgaatta
aagcatcttcgtgaatgtttctgtatccccaaagtcaaggatctgcctccaactgatctg
agcctggtgaacggagaggagagctgtatatactttgctgggaattctctcgggctccag
ccaagaaaagttaaaacttacttggatgaagaactggacaagtgggctcgaacaggtgtt
catggccatttcaatggtcagcgcccatgggctttggcagacgagtgcatcctagacctg
atggctgagctggttggggcccaaagacaggaactagccttaatgaatgggctaactgtt
aacttgcacctccagttgttatctttctttaagcctactccaagacgctataaaattctt
ctagaagccaaagccttcccctctgaccattacgctgttgagtcccagcttcgccttcac
gggctggatgtggagcagtgcatgcttttggtgcagccgcgggagggggaggagaccttg
agaattgaagatatccttgctgtaattgagaaggaaggggactcgatcgctgtcattctg
ttcagtggggtgcagtactacacggggcaattgtttgatatccctagaataacaaaggct
ggccatgaaaagggttgctttgttggatttgacctggctcacgctgttgggaatgtagag
cttcatttgcatgactggggagtagattttgcgtgctggtgttcctacaagtatttaaat
tctggagcaggaggccttgctggtgcctacattcatgagaagcattcccagactattaaa
cctacgctgattggctggtggggtcatgacttcaaaacacgattcctcatggaaaacaaa
ttgcaactaagtgaaggaattaatggatttcggttatcaaatcctccaattttactggtc
tgtgctctgcaagccagtttagaggtttttggtgaaactacaatgaaagcattgagaagg
aaatctgttctactcacgggttacttggaatacctgatcagacattactacagtgaggat
aagacaaatccagagaaacccttcataaaaatagtcacaccatcgcagattgaggaaaga
ggatgccagctcactctatctttttcccttccaatcaaatctgtgtttcaagagctggag
aagagaggagtagcttgtgacatacgagaaccaaatgctcttcgtgttgccccagttcct
ctctacaattctttccatgatgtgcacagatttattgaaatcctgggatctgcaattaca
tcttcaaaacaaacagcaaataatactgtgctatctggttcttattga

DBGET integrated database retrieval system