KEGG   Falco peregrinus (peregrine falcon): 101917142Help
Entry
101917142         CDS       T02856                                 

Definition
erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101917142
Cellular antigens [BR:fpg04090]
 Proteins
  101917142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 294 aa AA seqDB search
MEHLVLGLVLLAGKLAAGSPLHQQDLDPVKEVALDMAPTSFDDRYQGCSHMMEEELQELN
HTEFANNSIYAKAWTVATAEWRSRRGRAPQTRALTPAQAIALLAYTEQGPLHQAFNTAVR
KAGHSRREYLGAFQFKVLHFLLSEALCTLRDAQPHHCHHVYRGIRGIRFTAQRHQSIRFG
HFTSTSLRNESTLPFGRDTFFSVETCYGVPIRDFSFFPEEEEVLIPPFETFQVIDITHDG
DRALIQLRSQGALSTYNCELVKEKRCKSQPCIFSAGESSPIPRTQVTPGSLDVL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctggtgctgggcttggtgctgctggctgggaaactggctgctggcagcccc
ttgcaccagcaagacctcgaccctgtcaaggaggtggcgctggacatggcccccacctcc
tttgatgaccggtaccagggctgcagccacatgatggaggaggagctgcaggagctcaac
cacactgagtttgccaacaacagcatctacgccaaggcctggactgttgccactgctgaa
tggcggagccggcggggacgtgctcctcagacacgagcactgacaccagcgcaggcgatt
gccctactggcatatacggaacagggccccctgcaccaggcgttcaacacagctgttcgc
aaggctgggcactcccgcagggaatacctgggtgccttccagttcaaggtgctgcatttc
ctcctgagcgaggccctgtgcactctgcgggatgcccagccccaccactgccaccacgtt
taccggggcatccgtggcatacgcttcactgcccagcgccaccaatccatccgcttcggc
cacttcacctccacctccctccggaatgagagcaccctgccctttggccgggacaccttc
ttttcagtggagacctgctacggtgtccccatcagagacttctccttcttccctgaggag
gaagaggtcctcatcccacccttcgagaccttccaggtcatcgacatcacccatgatggg
gacagagccctcatccagctccgctcccagggtgcgctgagcacctacaactgcgagttg
gtgaaagagaagagatgcaagagccagccgtgcatcttcagcgcaggtgagagcagcccc
atccccaggacacaggtgacaccgggcagccttgatgtgctttaa

DBGET integrated database retrieval system