KEGG   Falco peregrinus (peregrine falcon): 101918141Help
Entry
101918141         CDS       T02856                                 

Gene name
SDHB
Definition
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Orthology
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101918141 (SDHB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101918141 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    101918141 (SDHB)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101918141 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 260 aa AA seqDB search
MNTQMCRGVQTAAAAAPRMKKFAIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIK
NELDSTLTFRRSCREGICGSCAMNIAGGNTLACIKRIDTDLTKTTKIYPLPHMYVVKDLV
PDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYW
WNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPG
KAIAEIKKMMATYKEKATAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaaatgtgtcggggagtgcagacagcagctgcggcagcgccccgtatgaag
aagtttgccatttacagatgggatcccgataagcctggggacaagccccgcatgcagaca
tatgaagtggatttgaataaatgcggacctatggtgctcgatgctctgatcaaaataaaa
aatgagttggactccactctgactttccgcagatcatgtagagaaggcatctgtggctct
tgtgctatgaacattgctggcggaaacacactggcctgtatcaaaagaattgacaccgat
ctcaccaagaccactaaaatctaccctctcccccacatgtatgtggtgaaggaccttgtc
ccggacttgagcaacttctatgcacagtacaaatccattgagccttacctgaagaagaag
gatgagtcaaaacagggcaaggagcagtacctgcagtccatagaagaccgtcagaaactg
gacggactctacgagtgcatcctgtgtgcctgctgcagcaccagctgtcccagttactgg
tggaacggggacaagtacttgggtcctgcagtactgatgcaggcctatcgctggatgatt
gactccagagatgactacacagaggaacgcctggcacagcttcaagacccattttctctt
taccgttgtcacactatcatgaattgcacaaggacttgccctaagggtttgaaccctggc
aaagcaattgctgagatcaagaagatgatggcaacttacaaagagaaggcgaccgctgca
taa

DBGET integrated database retrieval system