KEGG   Falco peregrinus (peregrine falcon): 101918141Help
Entry
101918141         CDS       T02856                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101918141 (SDHB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101918141 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    101918141 (SDHB)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101918141 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 256 aa AA seqDB search
MCRGVQTAAAAAPRMKKFAIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELD
STLTFRRSCREGICGSCAMNIAGGNTLACIKRIDTDLTKTTKIYPLPHMYVVKDLVPDLS
NFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGD
KYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIA
EIKKMMATYKEKATAA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcggggagtgcagacagcagctgcggcagcgccccgtatgaagaagtttgccatt
tacagatgggatcccgataagcctggggacaagccccgcatgcagacatatgaagtggat
ttgaataaatgcggacctatggtgctcgatgctctgatcaaaataaaaaatgagttggac
tccactctgactttccgcagatcatgtagagaaggcatctgtggctcttgtgctatgaac
attgctggcggaaacacactggcctgtatcaaaagaattgacaccgatctcaccaagacc
actaaaatctaccctctcccccacatgtatgtggtgaaggaccttgtcccggacttgagc
aacttctatgcacagtacaaatccattgagccttacctgaagaagaaggatgagtcaaaa
cagggcaaggagcagtacctgcagtccatagaagaccgtcagaaactggacggactctac
gagtgcatcctgtgtgcctgctgcagcaccagctgtcccagttactggtggaacggggac
aagtacttgggtcctgcagtactgatgcaggcctatcgctggatgattgactccagagat
gactacacagaggaacgcctggcacagcttcaagacccattttctctttaccgttgtcac
actatcatgaattgcacaaggacttgccctaagggtttgaaccctggcaaagcaattgct
gagatcaagaagatgatggcaacttacaaagagaaggcgaccgctgcataa

DBGET integrated database retrieval system