KEGG   Falco peregrinus (peregrine falcon): 101918204Help
Entry
101918204         CDS       T02856                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
fpg  Falco peregrinus (peregrine falcon)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 314 aa AA seqDB search
MKKPLFFLVTGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLD
TIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKGLALSNSEV
IRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDD
WISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQRIAELQQQLAEEEPMDTDQSSN
MLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEK
AKEKQNAKKVQEAK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacctctatttttccttgttacaggttgtagaggagcacaagttgaagaaata
tggagtttggaaccagagaactttgaaaaattgaagccagtgcacggattaattttcctc
ttcaagtggcagcctggagaggaaccagcaggttctgttgttcaggattctagactggat
acaatattttttgctaaacaggtaatcaataatgcttgtgctactcaagccatagtaagt
gtgctattaaattgtgctcatcaagatatccatctaggagagactttgtcagaatttaaa
gaattttcacaaagttttgatgctgcgatgaaaggtttggcactaagcaactcggaagtg
attcggcaagttcacaacagttttgccagacaacagatgtttgaatttgatgcaaagtct
tcggcaaaagaagaagatgcatttcactttgtaagctatgttcctgttaatggacggcta
tatgaactagatggcttaagggaaggaccaattgacttgggtgcatgcaatcaagatgac
tggataagtgctgtacggcctgtcatagagaaacgtatacaaaagtacagcgaaggtgag
ataaggtttaacttgatggctattgtatctgacagaaagatgatatatgagcagaggatt
gcagaattacagcagcagcttgcagaggaggagcctatggatacagatcaaagtagtaat
atgttaagttctatacaatcagaagttgcaaaataccagatgttaattgaagaagagaac
caaaaattaaaaagatataagatcgaaaatattagaagaaaacataactacctgcctttc
atcatggaattattaaagactttagcagagcaccaacagttaataccattagtagaaaaa
gcgaaagaaaaacagaatgccaagaaagttcaggaggccaagtga

DBGET integrated database retrieval system