KEGG   Falco peregrinus (peregrine falcon): 101918284Help
Entry
101918284         CDS       T02856                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101918284 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1511 aa AA seqDB search
MSGLGDSSTDPANPDSRKRKGSPCDTAQSNEKRRREQENKYLEELAELLSANIGDIDTLS
VKPDKCKILKKTVDQIQQMKRLEQEKAADDEVQKSDISSSSQGVIEKESLGPLLLEALDG
FFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVP
WPQEATRRNSHTFSCRMLIRPPDEPGAENQEARQRYEVMQCFTVSQPKSFKEEGEDFQSC
LICIARRLPRPAAVTPSESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQP
QGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTVLSAHTKCKLCYPSSPEMQPFIMGIH
VIDRDHGMLSPQENTNSAMSLPRVSPSLNPSISPGQGMALPPSIPPSNGSMLATNVNQQP
GAGLHNSNSSTSQTSFGCSPGNQIGANVALSQGQAGPQNSNHTLNLSSSPMNSPGITPPQ
FMSPRHRVSPGLVPRPRVPSNPFSPTMPTMHSPVGMANSGSGGGCGTGGTRPFPSAPINS
MQGLTEGPSTPVGYSTPPPVLRQLSSQSSPGRLAMQPMKAESKDNKEIASILSEMIQSDG
GSGDGKPLDSGMLHASDRLSEGDSKCSQATSHKLVQLLATTAEQQLRHADADTSCKDSLA
CAGTAGTLASGNPPSSTCPSSHSSLTERHKILHRLLQEGSPSDITTLAMEHEKKETAPNP
ATTPTAQSQLPGTPDIKLEPDALKKKDVKDHQLLRYLLDKDEKELAAAPALSLDDVKVKV
EKTEQMEPCNTAPVPLAKPPAAEEVKLETQGQFAAELEQLDQLLPSLEKAAQLPGLCGPE
RSESGVASVAVKPEMLAAPLQPSATARAPTGLNPMSSGQGVQAGRTPFEFCDPLEPAQLR
PVPCPASNGSSPHTRGPAQQGRGTVTAPNPFPADTGRPELEMGVPDHQFGQPGMGEQIPW
TDNSMAAMNRGALNKPEDQCITSQLDELLCPPTTPEGRNDEKALLEQLVSFLSGKDETEL
AELDRALGIDKLVQGGGLEALTERVQPQQATPPLMMEQKPGMYPQPYSSASPTTNLPGAF
PGMVRQKPSFGPMPVQVPPPRSAFPTTMAMQPRQTLNRPPTAPNQLRLQLQQRLQGQQQL
IHQNRQAILNQFAANSPVGINMRAGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLMQ
QRAILMRQQSFGNNLPPSAGLPVQIGAARLPQAPPQQFPYPPNYGTTPGNPPTSTSPFSP
LASNPEAALANRSSMVNRGMMGGVGGQFGTGMTPQMQQNIFQYSGSGMGQQSEPAFAPSL
SPSSPLMSPQLPPSQSPMLQPAPPTPGYQSPDMKTWQQGAMGNSNVFSQAGQSQPAPAQQ
GMYNNMSITVSMAGGNTNVQNMNPMAGQMQMNSLQMPGMNSMCSEQVNDPALRPTGLYCN
QLSSTDLLKTEADGAQQVQQVQVFADVQCTVNLVGDPYLNPPAPLGTPKNAAGPPPPPGQ
QKSLLQQLLTE
NT seq 4536 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagctcaacggaccctgccaaccccgactctcggaagaggaaa
ggctcgccctgcgatacagcccagagcaatgaaaagcgacgacgggaacaggagaacaaa
tacttagaggagctggcggagctgttatctgcaaacatcggggacatcgacaccctgagt
gtcaaacccgacaaatgcaagatcctaaaaaagacggttgatcagatccagcagatgaag
aggttggagcaagagaaagcagctgatgatgaagtgcagaagtctgacatctcatccagc
agccaaggagtgattgaaaaggagtctctgggacctcttcttctggaggcgttggatggc
ttcttcttcgttgtgaaccgcgaagggaggatcgtcttcgtctctgagaacgtgaccagc
tacctgggttataaccaggaggagctcatgaacaccagtgtctacagcatcctgcacgtg
ggggatcacgccgagttcgtcaagaacttgttgccaaagtctctagtaaatggagttcct
tggcctcaagaagcaaccaggcgcaacagccataccttcagctgcaggatgctgatccgg
ccgcctgacgaaccaggtgctgagaaccaggaggctcgtcagcgctacgaggtgatgcag
tgcttcactgtctcccagcccaagtccttcaaggaggaaggagaagatttccagtcatgt
ctaatatgcattgcaaggcgattacctcgaccagcagccgtcaccccttccgaatccttc
gtgaccaagcaagacaccacaggtaaaatcatctccattgacaccagttccctgagagct
gctggcaggacgggctgggaggatttggtgcggaaatgcatctacgctttcttccagccg
cagggcagagagccatcttatgccaagcagctctttcaagaagtgatgacacgtggcacg
gccttcagcccctcgtaccgattcaccctgagcgacgggacggtgcttagtgcccacacc
aagtgtaagctctgctacccctccagcccagagatgcagcccttcatcatgggcatccac
gtcatcgacagggatcatggcatgctctcaccccaggagaacactaactccgcaatgtcc
cttccccgggtcagcccctcactgaaccccagcatctccccagggcaaggcatggccctg
ccgccctccatccctccctccaacggcagcatgttggccaccaacgtgaaccagcagcca
ggcgccggcctccacaacagcaactccagcaccagccaaaccagctttggatgttcacct
ggaaaccagataggagccaatgttgccttaagccagggacaagctggtccccagaacagt
aaccacactttgaacctcagtagctcccccatgaatagtccggggatcaccccaccacag
ttcatgtctccaaggcatcgggtcagcccagggctggtgcccagacccagggtgcccagc
aatcccttctcacccaccatgcccaccatgcactcccccgtgggcatggccaacagtggc
agtgggggcggctgtggcaccggtggcaccagaccctttcccagcgcccccataaactct
atgcaggggctgaccgaagggcccagcacaccggtgggctattccacgccaccccccgtg
ctgagacagctcagctcccagagctcgcccggccgcctcgccatgcagcccatgaaagca
gagtcgaaggacaacaaagagatcgcctccatcctgagcgagatgatccagtcggatggc
ggttcgggggatggaaaaccgctggactcgggcatgctgcacgccagcgacaggctctca
gagggggacagcaagtgctcccaagccaccagccacaagctggtccagctcctggccacc
acagcggagcagcagcttcggcacgctgatgcggacacgagctgcaaagattcattagcc
tgcgcgggcaccgccggcaccttggcctccggcaaccctcccagcagcacctgcccttcc
tcccatagctcactgaccgagcggcacaagatcttgcatagactccttcaggagggcagc
ccttcggatatcaccaccctggccatggagcacgagaagaaggagacggcgccgaaccct
gccaccacccccacggctcagagccagctgccgggcaccccggacatcaaactggagccg
gacgcgctgaagaaaaaagatgtcaaggatcaccagctcctgcgctatctgctggacaaa
gacgagaaggagcttgctgcagccccggcgctgagcctggatgatgtgaaggtgaaggtg
gagaagacggagcagatggagccttgtaacacagccccggtgccgctcgccaaacctcct
gcagcggaggaggtcaagctggagacgcagggccagtttgctgctgaactggagcagctg
gaccagctcctgccctcgctggagaaggcggctcagctgcccggcttgtgtggaccagag
agaagtgagagcggtgtggccagcgttgctgtcaaaccagagatgctggcagctcccctg
cagcccagcgccactgccagagcccccacgggactcaacccgatgagcagcgggcagggc
gtgcaggctggtcgcaccccatttgagttctgtgaccccctggagccagcccagctgagg
ccagtcccgtgccctgcgagcaacggcagcagcccgcacacccgtgggccagcccagcag
ggcaggggcacggtgaccgcaccaaaccccttcccagccgacacaggaaggcctgagctg
gagatgggggtgccggatcaccagtttggacagccaggaatgggggagcagatcccctgg
acggataacagcatggcagccatgaatcgcggtgcgctgaataaacccgaagaccagtgc
atcacctcccagctggatgagctcctgtgtcctcccaccacgccggagggtcggaacgac
gagaaagccctgctcgagcagctcgtctccttcctcagcggcaaagacgagacggagctg
gccgagctggatcgagctctggggattgacaaactggtccagggcggcgggttggaagcc
ctgacagagcgggtccagccccaacaagccaccccaccgctcatgatggagcagaaaccc
ggcatgtacccccagccttactcctccgcctctcccaccaccaacctccccggcgccttc
cccggcatggtcaggcagaagccgtccttcggacccatgccggtgcaggtcccgccgccc
cgcagcgccttccccaccaccatggccatgcaaccccggcagacgctcaacagacccccg
acggcccccaaccagctgcgacttcagctgcagcagcggctgcagggccagcagcagctg
atccatcaaaaccggcaggcgatcctcaaccagtttgcagccaattccccggtgggcatc
aacatgcgggcagggatgcagcagcagatcacgccgcagcctcccctcaatgcccagatg
ctggcccagcgccagcgcgagctctacagccagcagcaccggcagcggcagctcatgcag
cagcgagccatcctgatgaggcagcaaagctttggaaacaacctccctccctctgccggg
ctcccagtgcagatcggagccgctcgcttgccccaggcacccccacagcagttcccttac
cccccaaactacggtacgaccccaggaaaccctcccacctccaccagccccttctcaccg
ttggcatccaaccctgaggccgcgctggctaaccgcagcagcatggtgaacagggggatg
atgggcggcgtcggagggcagttcggcactgggatgaccccgcagatgcaacagaacatc
tttcagtattcgggatcaggcatgggtcagcaaagcgaacccgcctttgctccgtcgctc
agtcccagcagccccttgatgtcaccccagctcccgccttcgcaaagccccatgctgcag
ccagctccgccgacaccgggctaccagtcgcctgacatgaagacctggcagcagggagcc
atggggaacagcaatgtattcagccaagcggggcagagccagccggcgcctgctcagcag
ggcatgtacaacaacatgagcatcaccgtctccatggcgggaggaaacaccaacgtccag
aacatgaaccccatggccggacagatgcagatgaactcactgcagatgcccgggatgaac
tccatgtgctcggagcaggtaaatgacccggcgctgagacccacgggcctttactgcaac
cagctttcctccactgaccttttgaaaacagaagcagatggggcgcagcaggtacaacag
gttcaggtctttgccgacgtacagtgtacagtgaatctggtaggagatccctacctcaac
ccgccggctcccttgggcaccccgaaaaacgccgccgggccaccaccaccgccgggccag
cagaagagccttcttcagcagctactgactgaataa

DBGET integrated database retrieval system