KEGG   Falco peregrinus (peregrine falcon): 101918561Help
Entry
101918561         CDS       T02856                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101918561
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101918561
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101918561
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101918561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 486 aa AA seqDB search
MVCVCNATYCDTLDPVVLPAPGTYVKYESSKAGKRLERSEGSFQRSLCAPDLVLTVDTTQ
RYQKVKGFGGSVTDAAAMNVFSLPEAAQDHLLRSYFSEEGLEYNLVRLPMASCDFSLHAY
TYDDVPFDYELTHFSLRDEDTKLKIPLLHRALAMSKQRLSLYASPWTSPAWMKTSESFVG
KGTLKGQAGDKYHKTWANYFIRFLDEYAKHNLTFWAVTAENEPTAGLINNYPFQCLGFTA
EQQRDFIARDLGPALANSSHSNIRLIILDDNRLHLPHWAKVVLEDEEAARYVHGIGIHWY
LDFIGPIQDTVVPTHELFPDYFILATEACIGAHFWERDVILGCWERGNQYSHSILMNLNH
FVAGWTDWNLALDLEGGPNWVKNYVDSPVIVDSSEGIFYKQPMFYHMGHFSKFIPEGSQR
VGLVASKESKKTDLEYTAFLRPDGAMVVVVLNRSPQNITFGLADTVGLIAAMAPASSIQT
YLWQRQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcgtctgcaacgccacgtactgcgacacgctggaccccgtggtcctgccggcc
ccgggcacctacgtcaagtacgagagcagcaaggctggcaagcggctggagcgcagcgag
ggaagcttccagcgcagcctgtgcgccccagatctcgtcctgacggtggacacaacgcag
cggtaccagaaggtgaagggtttcggcggctctgtcactgatgctgctgccatgaatgtg
ttttccctgccagaagcagcccaggatcacctgctgcgctcgtacttctcagaggaaggg
ctggagtacaacctcgtccggctccctatggccagctgcgacttctccctccacgcctac
acctacgacgatgttccctttgactacgagctcacccacttcagcctgcgagacgaggac
acgaagttgaaaatccccctcctgcaccgagccttggccatgagcaagcagcggctgtcc
ctgtatgccagcccctggacctccccggcctggatgaagaccagtgagtccttcgtaggg
aagggcacgctgaaggggcaggcaggggacaagtaccacaagacctgggccaactacttc
atacggttcctggacgaatacgccaagcacaacctgaccttctgggcggtgacggcagag
aacgagcccacggctgggctcatcaacaactaccccttccagtgcctgggcttcacagcc
gagcagcagcgtgacttcatcgcacgggacctgggccctgcgctggccaacagctcccac
agcaacatccgactcatcatcctggatgacaaccggctccacctcccacactgggccaaa
gtggtcctggaggatgaagaggcagctcgctatgttcatggcatcggcatccactggtac
ctggacttcattggtcccatacaggacacggtggtgcccactcatgagcttttccccgac
tacttcatcctggccacggaggcatgcatcggggcccatttctgggagagagatgtgatc
ctgggctgctgggagcgagggaaccagtacagccacagcatcctgatgaacctgaaccac
tttgtggccggctggaccgactggaacctggccctggacctggaggggggccccaactgg
gtcaagaactatgtggacagccccgtcatcgtggacagcagtgaaggcatcttctacaag
cagcccatgttctaccacatggggcacttcagtaagttcatccctgagggctcccagcgt
gtggggctggttgcctccaaagagtccaagaagacggacctggagtacacggctttcctg
cgccccgatggtgccatggtggtggtggttctgaaccggtccccacagaacatcaccttc
gggctggctgatacggttggcctcattgccgccatggctccagccagctccatccagacc
tacctgtggcagcggcagtga

DBGET integrated database retrieval system