KEGG   Falco peregrinus (peregrine falcon): 101918561Help
Entry
101918561         CDS       T02856                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fpg00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fpg00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:fpg04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 486 aa AA seqDB search
MVCVCNATYCDTLDPVVLPAPGTYVKYESSKAGKRLERSEGSFQRSLCAPDLVLTVDTTQ
RYQKVKGFGGSVTDAAAMNVFSLPEAAQDHLLRSYFSEEGLEYNLVRLPMASCDFSLHAY
TYDDVPFDYELTHFSLRDEDTKLKIPLLHRALAMSKQRLSLYASPWTSPAWMKTSESFVG
KGTLKGQAGDKYHKTWANYFIRFLDEYAKHNLTFWAVTAENEPTAGLINNYPFQCLGFTA
EQQRDFIARDLGPALANSSHSNIRLIILDDNRLHLPHWAKVVLEDEEAARYVHGIGIHWY
LDFIGPIQDTVVPTHELFPDYFILATEACIGAHFWERDVILGCWERGNQYSHSILMNLNH
FVAGWTDWNLALDLEGGPNWVKNYVDSPVIVDSSEGIFYKQPMFYHMGHFSKFIPEGSQR
VGLVASKESKKTDLEYTAFLRPDGAMVVVVLNRSPQNITFGLADTVGLIAAMAPASSIQT
YLWQRQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcgtctgcaacgccacgtactgcgacacgctggaccccgtggtcctgccggcc
ccgggcacctacgtcaagtacgagagcagcaaggctggcaagcggctggagcgcagcgag
ggaagcttccagcgcagcctgtgcgccccagatctcgtcctgacggtggacacaacgcag
cggtaccagaaggtgaagggtttcggcggctctgtcactgatgctgctgccatgaatgtg
ttttccctgccagaagcagcccaggatcacctgctgcgctcgtacttctcagaggaaggg
ctggagtacaacctcgtccggctccctatggccagctgcgacttctccctccacgcctac
acctacgacgatgttccctttgactacgagctcacccacttcagcctgcgagacgaggac
acgaagttgaaaatccccctcctgcaccgagccttggccatgagcaagcagcggctgtcc
ctgtatgccagcccctggacctccccggcctggatgaagaccagtgagtccttcgtaggg
aagggcacgctgaaggggcaggcaggggacaagtaccacaagacctgggccaactacttc
atacggttcctggacgaatacgccaagcacaacctgaccttctgggcggtgacggcagag
aacgagcccacggctgggctcatcaacaactaccccttccagtgcctgggcttcacagcc
gagcagcagcgtgacttcatcgcacgggacctgggccctgcgctggccaacagctcccac
agcaacatccgactcatcatcctggatgacaaccggctccacctcccacactgggccaaa
gtggtcctggaggatgaagaggcagctcgctatgttcatggcatcggcatccactggtac
ctggacttcattggtcccatacaggacacggtggtgcccactcatgagcttttccccgac
tacttcatcctggccacggaggcatgcatcggggcccatttctgggagagagatgtgatc
ctgggctgctgggagcgagggaaccagtacagccacagcatcctgatgaacctgaaccac
tttgtggccggctggaccgactggaacctggccctggacctggaggggggccccaactgg
gtcaagaactatgtggacagccccgtcatcgtggacagcagtgaaggcatcttctacaag
cagcccatgttctaccacatggggcacttcagtaagttcatccctgagggctcccagcgt
gtggggctggttgcctccaaagagtccaagaagacggacctggagtacacggctttcctg
cgccccgatggtgccatggtggtggtggttctgaaccggtccccacagaacatcaccttc
gggctggctgatacggttggcctcattgccgccatggctccagccagctccatccagacc
tacctgtggcagcggcagtga

DBGET integrated database retrieval system