KEGG   Falco peregrinus (peregrine falcon): 101918738Help
Entry
101918738         CDS       T02856                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101918738 (ART4)
Cellular antigens [BR:fpg04090]
 Proteins
  101918738 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 298 aa AA seqDB search
MFFTVSWVNSRMPVLLASLLLLIPSQMLIKGAVSHLMMDMALHSFDXXYLGCRDQVMEEL
DXDYFRKETAANKDYLSLWKKAQEALLKSPVGLLREMHESHAMAYTMNSSLHCQLNWATS
IAGSSPEHYRHKFSFKYFHLNLTTAIQIMKQWQSNKESMVKHKRXXVHRGVKDLYIEARV
GSRVQFVHFTSTSHLWNEAQKSGKETSFTVTTCLGAAAQGFSYYTSEKEVLIPLYEILFV
KXQTQHGNWLHLQSVGNYSKYHCQLMEGSRSKNSYSTALTSATLPSVVGVFMCLACDD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttttttacagtgtcttgggtgaactctaggatgccagtgctgctggccagccttctc
ttgctgatcccctcacaaatgctgataaaaggggctgtgtcccacctcatgatggatatg
gctctgcattcctttgattagtagtatctggggtgtagagatcaggtgatggaagaactg
gactgagactatttccgaaaggagacagctgctaacaaggactatttgagtctctggaag
aaggctcaagaggctttgttaaagagccctgtaggtctcctgagggagatgcatgagagc
catgccatggcttacaccatgaattcttccttgcactgtcagctgaactgggccacatct
atagcaggaagctctccagagcactacagacacaagttcagtttcaaatattttcacttg
aacctaacgactgctattcagataatgaagcaatggcagagcaacaaggagagcatggtg
aaacataagcgctaataagtgcacaggggtgtaaaagatttatatattgaggccagggta
ggcagcagggtgcaatttgtccatttcacctccacctcccacctctggaatgaagcccag
aagtctgggaaagaaacttcgttcacagtgacaacttgcctgggagcagctgcacaaggc
ttttcttactacacatctgagaaggaagtcctcattcccctgtacgagatactctttgtc
aaanttcagacacagcatggtaactggctgcatctgcagtctgtggggaactacagtaag
taccactgccagctcatggaaggttcaagaagcaagaacagctactccactgccctcacc
tctgccactcttcccagtgtagttggagttttcatgtgcttggcctgcgatgactga

DBGET integrated database retrieval system