KEGG   Falco peregrinus (peregrine falcon): 101919374Help
Entry
101919374         CDS       T02856                                 

Gene name
CKMT1B
Definition
creatine kinase, mitochondrial 1B
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101919374 (CKMT1B)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     101919374 (CKMT1B)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101919374 (CKMT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 398 aa AA seqDB search
MAKESAVGVLPCQSPRECKNKHKAWLKGLISLSSHSAEYPDLRKHNNCMASNLTPAIYAR
LCDKATPNGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYN
PRTMKHVTDLDASKIKFGHFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVAVEA
LNGLTGDLAGRYYRLSEMTEKEQQQLIDLVHLLHGRLGAVRRDALAPAMQPGHNNEKTFL
IWINEEDHTRIISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSN
LGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSE
VELVQLVIDGVNYLIDCERRLEKGQDIRIPSPVPQFRH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggagagtgctgtcggggtcctgccctgccaatccccccgtgagtgcaagaac
aagcacaaagcctggctaaaaggactcatcagcctctcctcccacagcgctgagtacccc
gacctacggaagcacaacaactgcatggccagcaacctgacgccagccatctatgccagg
ctctgtgacaaagcaacccctaacggctggaccttggaccagtgcatccagacaggtgtt
gacaaccctggccaccctttcatcaagacggtgggcatggtagctggtgatgaagaaacc
tacgaggtgtttgctgacctgttcgacccagtgattcaggagcggcacaatgggtacaat
ccccgcaccatgaagcacgtcacagacctggatgccagcaagatcaagtttggccacttc
gatgagcgctacgtgctctcatcccgggtccggactgggcgcagcatccgtgggctgagc
ctgccaccagcctgcacccgtgctgagcggcgagaggtggagaaggtggctgtggaggcg
ctgaacggcctcaccggagacctggcgggccggtactaccgtctcagcgagatgacagag
aaggagcaacagcagctcattgacctggtacatctcctgcacggcaggctgggggcggtg
agacgggatgccctggcaccagccatgcagcccgggcacaacaacgagaagaccttcctg
atctggatcaacgaggaagaccacacgcgcatcatctccatggagaagggtggcaacatg
aagcgcgtcttcgagcggttctgtcgggggctgaaggaggtggaacggctaatccaggag
cgaggctgggagttcatgtggaacgagcggctgggttacatcctgacctgcccctccaac
ctgggcactgggctgcgagcaggcgtccacatcaagctgccgctgctcagtaaggacagc
cgcttccctaagatcctggagaacctccggctacagaagcgcgggacgggtggtgtggac
accgcagctactggcagcgtcttcgacatttccaacctggaccggctggggaagtcagag
gtggagctggtgcagctggtgatagacggtgtgaactacctgattgactgtgagcgacgg
ctggagaaggggcaggacatccgcatcccctccccagtgccacagttccggcactga

DBGET integrated database retrieval system