KEGG   Falco peregrinus (peregrine falcon): 101920316Help
Entry
101920316         CDS       T02856                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101920316 (ABHD12)
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101920316 (ABHD12)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101920316 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 363 aa AA seqDB search
MEAGFDRQEDSPFPVTALEIMPKTYPGLKRYGLWFRLRKLIIWLLGVYIAIPFLVKLCPA
IQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAALWKNARGK
DQLWFEDALGSSHPVILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSIGSP
SERGMTYDALHVFDWIKARSGDNPVYVWGHSLGTGVATNLVRRLCERETPPDALILESPF
TNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDENVKYISCSLLILHAEDDPV
VPFQLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYRSPELPRILREFLGKSEHE
HHH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaggttttgacagacaagaggatagcccattccctgtgactgctctagaaatc
atgccaaaaacttacccaggtttaaagcgatatggattatggtttcggttgcggaagtta
ataatctggttgctgggagtgtacatagccattccatttctagtaaaactttgccctgct
attcaggcaaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaa
agaccacaggatcaaggtttaaaccacacctgtaattattatctgcagccagaggaggat
gtaaccattggagtgtggcatacggtccctgcagccttatggaagaatgcccgagggaag
gaccagttgtggtttgaagatgctttgggttccagccatcctgtaatcctttacttgcac
ggcaatgcgggaacaagaggaggggatcaccgcgtggagctttacaaggttctcagctcc
ctcgggtaccatgtggtcacgtttgattatcgaggctggggtgattcgataggcagcccg
tcagagaggggaatgacctacgacgcccttcatgtctttgactggataaaagcaagaagt
ggagacaaccctgtctatgtatggggacactccttgggcacaggggttgcaacaaatctc
gtgaggcgcctttgtgagagagaaacgcccccggatgccctgatcctggaatctccattc
acgaacatacgggaggaggcgcgaagtcaccccttttctgtgatatacagatacttccct
ggctttgactggttcttccttgaccccatcacgacaagtggaattaaatttgcaaatgat
gagaatgtgaaatacatttcatgctccctactcatccttcatgctgaggatgacccagtg
gtaccatttcagctgggaaagaagctttacaacattgctgcaacgtcacggagtttccga
gactacaaggtgcagtttgttccattccacacagaccttggctaccggcacaagtacatc
tacaggagtccagagctacctcgaatactgcgggaattcctcggaaaatctgaacatgag
catcatcactga

DBGET integrated database retrieval system