KEGG   Falco peregrinus (peregrine falcon): 101920451Help
Entry
101920451         CDS       T02856                                 

Definition
fatty acyl-CoA hydrolase precursor, medium chain-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101920451
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101920451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 557 aa AA seqDB search
MAAGKDTSLLSLILTVGVTALVATGQKAEQPEVMTNYGRVRGYQFKVDAAGRNVNVFLGL
PFAKPPVGPLRFSEPQPPEPWKGVRDATSYPPMCLQDKELGQYFSDVVTNRKENVLLQMS
EDCLYLNVYTPVSTGNQEKLPVFVWIHGGGFIFGAASSYDGSALAAFDNVVVVVIQYRLG
IVGYFSTGDKHARGNWGYLDQVRALQWVQENIIYFGGDPGSVTIAGESAGGISISALVLS
PLGKGLFHKAISESGTAIRALFTDHPENEAQRIAFASGCGKSSSAEVVECLREKTEEEIV
QITLKLRSLFISTTIDGVFFPKSPKQLLSEKMITAVPYIIGVNNCEFGWAVPTIMKLPPY
TDGLDTDVAYQVLQSFLSSSFQGVTSEFVDQVYNEYIGNTGNRTQVRDGLFDAMGDSLLV
ISAVEVARYHRDAGNPVYFYEFQHRQSSAAGVVPDFVKADHADEIAFVFGKPFLAGYTTE
EENKLSRTVMKYWTNFARNGNPNGEGLVHWPQYDLDEGYLEIDLVQKASKKLKERKMEFW
AQLTKQIMNERREHTDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcagctggaaaggacacatcactgctgtcattgattctcaccgttggagtcacagcg
ctggtagctactggacaaaaagcagagcaaccagaagtgatgaccaactatgggagagta
cgagggtaccaattcaaagtagacgctgctgggaggaatgtaaatgtctttctgggactt
ccttttgctaagcctccagttggaccactgaggttttctgaaccccagccacccgagcca
tggaaaggtgtcagagatgccacttcctacccaccaatgtgtctacaggataaagaacta
ggacagtatttttcggatgttgttactaatagaaaagagaatgttcttctccaaatgtct
gaagattgcttatacctaaatgtgtacacacccgtttctacaggaaatcaggagaagctg
cctgtctttgtatggatacatggaggtggattcatttttggagcagcttcatcatatgat
ggttcagcattagcagcctttgacaatgtggtggttgtagtaattcagtacagattaggt
attgttggatattttagcactggtgataagcatgctcgaggtaactgggggtatttagat
caagtaagagctcttcagtgggttcaggaaaatatcatatattttggaggagatccggga
tctgtcactatcgctggagaatctgcaggaggaatcagcatttctgctcttgtcttatct
cccctgggaaagggcttgttccataaggccatttcagagagtggtactgcaatcagggct
ttgttcactgaccatcctgagaacgaagcacaaagaattgcttttgcttctggctgtgga
aaatccagttcagctgaagtagttgaatgcttaagagaaaaaacagaagaagagatagta
cagataacactaaaattgcgttccctgttcatcagcacaactatagatggtgtatttttt
ccaaagagtcccaagcagttactatctgaaaaaatgatcactgcagtcccatatataata
ggagtaaataactgtgaatttggatgggcagttcctacaataatgaaattacctccttac
acagatggtctggacacagatgttgcatatcaagttttacagagcttcttatcatcctca
tttcagggtgttacttctgaatttgttgatcaagtatacaatgaatacatagggaataca
ggaaaccgtactcaagtgcgagatggcctttttgatgcaatgggagactccttgcttgtg
atttcagccgttgaggtggctagataccatagagatgctggcaacccagtctacttttat
gaatttcaacatcgacaaagttcagcggcaggtgttgtaccagactttgtaaaagcagat
catgcagatgagattgcctttgtctttggaaagccgttcttagccgggtatactacagaa
gaagaaaataaacttagcagaactgttatgaaatattggactaactttgctagaaatgga
aatcccaacggagaaggcttggtccattggcctcagtatgatctggatgaaggatacctg
gaaatagacctagtgcaaaaggcatcaaagaaattgaaagaacgcaaaatggagttttgg
gcacagctcacaaaacaaattatgaatgaaaggagagaacacacagatttgtag

DBGET integrated database retrieval system