KEGG   Falco peregrinus (peregrine falcon): 101920637Help
Entry
101920637         CDS       T02856                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101920637 (KAT2A)
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101920637 (KAT2A)
Transcription machinery [BR:fpg03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101920637 (KAT2A)
Chromosome [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101920637 (KAT2A)
   HAT complexes
    PCAF complex
     101920637 (KAT2A)
    STAGA complex
     101920637 (KAT2A)
    TFTC complex
     101920637 (KAT2A)
    SAGA complex
     101920637 (KAT2A)
    SLIK complex
     101920637 (KAT2A)
    ADA-HAT complex
     101920637 (KAT2A)
    HAT-A2 complex
     101920637 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 793 aa AA seqDB search
MAPRRRHGPARGSRGSWSPLSPDLDLSVAGSRRPRPRWEFRSRSGLQAAQVRGFPRGKKL
EKLGVFSACKANDACKCNGWKNPNPPTAPRMDLQQPVTNLSEPCRSCSHALADHVSHLEN
VSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVEGSLGS
PPFEKPNIEQGVLNFVQYKFSHLPPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQND
DVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLKSIFTVTRRQLLEKFRVEKDK
LVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPAAEGAQLVSRPAAVSTVTVPT
TPLFSKKLSNSSSAASMDASTPEPLPGEKRKLPESLTLEDAKRIRVMGDIPMELVNEVML
TITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQ
NVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSN
EQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKD
YEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRQIP
IESVPGIRETGWKPLGKEKGKELKDPDQLYNTLKNLLAQIKTHPSAWPFMEPVKKSEAPD
YYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANTLEKF
FYFKLKEGGLIDK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgccgccggcacggccccgcgaggggctctcggggtagttggtccccgttg
agcccggacctcgatctctccgtggcgggttcacgccgcccgcggcctcggtgggagttc
cgctcccgctcggggctgcaggcggcgcaggtgcgcgggttcccccgcggcaagaagctg
gagaagctgggggtcttctcggcctgcaaggccaatgacgcctgcaagtgcaacggctgg
aagaaccccaaccctcccactgccccccgcatggacctgcagcagccggtgaccaacctg
agcgagccctgccggagctgcagccatgcgctggcggaccatgtgtcccacctggagaac
gtttcggaggaggagatcaaccggttgctgggcatggtggtggatgtggaaaacctcttt
atgtcggtgcacaaggaggaggacacggacaccaagcaggtgtatttctacctgttcaag
ctcctgcggaagtgcatcctgcagatgagccagcctgtggtcgaggggtccctggggagc
ccccccttcgagaaaccaaacatcgaacagggagtcctgaacttcgtccagtacaagttc
agccacttgccacccaaggagcggcaaaccatgtacgagctctccaagatgttcctgctc
tgcctcaactactggaagctggagacaccgtcccagttccggcagcgctcgcagaacgat
gatgtggccacctacaaggtcaactacacaaggtggctgtgctactgccatgttccgcag
agctgtgacagccttccccgctacgagaccacccacgtctttgggcgcagcctcctcaag
tccatctttacggtcacccgccggcagctgctggagaagttccgggtggagaaggacaag
ctggtgccggagaagcggacactgattctcacccacttccccaagttcctgtccatgctg
gaggaggagatctatggcgagaactctccgatctgggaggctgatttcaccgtgccagct
gcagagggtgcccagctggtgtctcgcccagctgcggtcagcaccgttacagtgcccacc
actccactcttcagcaagaagctcagcaacagcagctctgctgcgagcatggatgccagc
accccagagcccctgccaggggagaagcggaagctgcccgagagcctgacactggaagat
gccaagcggatccgtgtcatgggagacatccccatggagctggtgaacgaggtgatgctg
accatcacggaccctgctgccatgctgggccccgagaccagcctgctgtcggcaaacgcg
gcacgggatgagacggctcggctggaggagcgccgtggcatcatcgagttccatgtcatc
ggcaactcgctctcacagaagtccaacaagaagatcctgatgtggctggtgggcttgcag
aacgtcttctcacaccagctaccacgcatgcccaaggagtacatcactcgccttgtcttt
gacccgaagcacaagaccctggcactgatcaaggacggccgagtgatcggggggatctgc
ttccgcatgttccccacccagggcttcacggagatagtcttctgtgccgtcacatccaac
gagcaagtgaagggctacgggacgcacctgatgaaccacctgaaggagtaccacatcaag
cacaacatcctctacttcctcacctacgcggatgagtacgccattggctacttcaagaag
cagggcttttccaaggacatcaaggtccccaagagccgctacctgggctatatcaaggac
tacgagggggcgaccctgatggagtgtgagctgaacccccgcatcccctacactgagctc
tcccacatcatcaagaagcagaaggagatcatcaagaagctgatagagaggaagcaagcg
cagatccgcaaggtctatcccggcctgacctgcttcaaggagggcgtgcggcagatcccc
atcgagagcgtccccggcatccgagaaacgggatggaaaccactggggaaggagaaggga
aaagagctgaaggacccggaccagctctacaacaccctgaagaacctcctggcccagatc
aagacccaccccagcgcgtggcccttcatggagcctgtgaagaagtcggaggcgccggat
tactacgaaatcatccgcttccccatcgacctgaagaccatgacagagcgcctgaagaac
cgctactacgtcaccaagaagctgttcatcgccgacctgcagcgcatcatcaccaactgc
cgcgagtacaacccgcctgacagcgactactgcaagtgtgccaacaccctggagaagttc
ttctacttcaagctcaaggagggggggctcatcgacaagtag

DBGET integrated database retrieval system