KEGG   Falco peregrinus (peregrine falcon): 101920764Help
Entry
101920764         CDS       T02856                                 

Definition
histone acetyltransferase KAT8-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101920764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 412 aa AA seqDB search
MAWILSQWDWEHWDQSGSYPSGDGVDPIPAKPGPSSPPDSAEVIQSRLNEQEGREEYYVH
YVGFNRRLDEWVDKNRLALTKTLKEAVQKSSEQFLGELAEQPERKITRNQKRKHDEINHV
QKVLGGTGRGLEGDWXGLGSTGRVLEGTGRIDAWYFSPFPEDYGKQPKLWICEYCLKYMK
YERTYRLHLVGTRLRHAWDSPHGXXXXXXXXISVDEVDGKDHKIYCQNLCLLAKLFLDHK
TLYFDVEPFVFYLLTEVDRQGAHIVGYFSKEKESPDGNNVGSPEKPLSDLGKLSYRSYWS
WVLLEILRDFRGTLSIKDLSQMTSITQTDIISTLQSLNMVKYWKGQHVICVTPKLVEEHL
KSAQYKKPPITAMMGSTTHVGCHESRWVLLAVLGAKVGPISHVGWHLGCQKP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggatcctatcccagtgggactgggagcactgggaccagagtggatcctatccc
agtggtgacggggtggatcctatcccagccaaacctggtcccagttcccccccagactcc
gccgaggtgatccagtcccgcctgaacgagcaggaaggtcgcgaggaatattacgtccac
tacgtgggctttaaccggcggctggacgaatgggtggataagaaccggctggcgctgacg
aagacgctgaaggaggcggtacagaaaagttcggagcaattcttgggcgaactggccgag
cagcccgagcgcaagatcacccgcaaccagaaacgcaagcacgatgagatcaaccacgtc
cagaaggtcctggggggcactgggagggggctagagggggactggtagggactgggaagc
actgggagggtgttggagggcactgggaggatcgacgcctggtacttctcgcccttcccg
gaggattatgggaagcagcccaagctgtggatctgcgagtactgcctcaagtacatgaag
tacgagcgcacctaccgcctccacctggtagggacacgcctgcgacacgcgtgggacagc
ccacacggnnnnnnnnnnnnnnnnnnnnnnnngatctcggtcgacgaggtggacggcaaa
gaccacaagatctactgccagaacctgtgcctgctggccaagcttttcctggaccacaag
acgctttatttcgacgtggaacctttcgtcttctacctgctgacggaggtggatcgccag
ggcgcccacatcgtgggctacttctccaaggagaaggagtcgcccgacgggaataacgtg
ggctcccccgagaagccgctgtcggacctgggcaagctgagctaccgcagctactggtcc
tgggtgctgctggagatcctgcgcgacttccgcggcaccctctccatcaaggacctcagc
cagatgaccagtatcacccagaccgacatcatcagcaccctccagtccctcaacatggtg
aagtactggaaggggcagcacgtcatctgcgtcacccccaaactggtggaggaacatctc
aagagcgcccagtacaagaaaccccccattactgccatgatgggttccactacccacgtt
gggtgccatgagtcacgttgggtgctcttggccgtcttgggcgccaaggtgggtcccatc
agccacgttggatggcatcttgggtgccagaagccatga

DBGET integrated database retrieval system