KEGG   Falco peregrinus (peregrine falcon): 101920889Help
Entry
101920889         CDS       T02856                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fpg00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 306 aa AA seqDB search
MCLNTLSVLIQLGRFVTYPIWLIYTTILRRLFGSHNHAITLEDPEVKYALRLIDKEEVSH
DTRRFRFALPSRDHILGLPVGQHIYLSARIDGALVVRPYTPVSSYDDKGFVDLVVKVYFR
GVHPKFPDGGKMSQYIDGLKIGDTIDFRGPSGLLVYKGKGTFAIRPEKKAEPVIKKVKYV
GMIAGGTGITPMLQIIRAIIKDKHDPTICQLLFANQTEKDILLRSELEEIQVQNPGRLKC
WYTLDRAPENWEYSQGFVNQEMMKDHLPPPQNDVLILMCGPPPMIQYACIPNLDKLGYTK
DMRFSF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcttaacactctttctgtgttgatacagttgggtcgctttgtgacatacccaata
tggctaatctacaccaccatcctgaggaggcttttcgggagtcacaatcatgcaattact
ctggaggatcctgaagtgaagtatgcattgaggctgattgataaggaggaagttagtcat
gatacaagaagatttcgatttgctctcccttctagagaccatattctgggtctccctgta
ggacagcatatctacctgtctgcacggattgatggagctctggttgttagaccttacact
ccggtttctagttacgatgacaaaggctttgtggatcttgttgtcaaggtctacttcaga
ggtgtccatccaaagtttcctgatggagggaagatgtcccagtacatagacggcctgaaa
ataggggatactattgacttcagaggaccaagtggcctacttgtctacaaaggaaaagga
acgtttgctattcggcctgaaaagaaagctgaaccagttattaagaaagtgaaatatgtg
gggatgattgcaggtgggactgggataacacctatgctgcagatcattcgagcaatcata
aaagacaaacacgaccctaccatttgtcagctgctctttgctaatcagacagagaaagat
atcctgttacgttccgagctagaggagatccaggttcagaatcccggtcgcttgaagtgc
tggtacacgctggacagagcacctgagaattgggagtacagccaaggatttgtgaaccaa
gagatgatgaaagaccacctgcccccacctcaaaatgatgttctgatcctcatgtgtgga
cctcctcccatgatccaatatgcttgcattcctaacttggacaaactgggctacaccaag
gacatgaggttctctttctaa

DBGET integrated database retrieval system