KEGG   Falco peregrinus (peregrine falcon): 101920889Help
Entry
101920889         CDS       T02856                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 3
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101920889
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101920889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 344 aa AA seqDB search
MSFLVAQLGSAFWITIAPNEPGCWLSPAWTSWRDSGPSAVPGQGPGPHSLGRFVTYPIWL
IYTTILRRLFGSHNHAITLEDPEVKYALRLIDKEEVSHDTRRFRFALPSRDHILGLPVGQ
HIYLSARIDGALVVRPYTPVSSYDDKGFVDLVVKVYFRGVHPKFPDGGKMSQYIDGLKIG
DTIDFRGPSGLLVYKGKGTFAIRPEKKAEPVIKKVKYVGMIAGGTGITPMLQIIRAIIKD
KHDPTICQLLFANQTEKDILLRSELEEIQVQNPGRLKCWYTLDRAPENWEYSQGFVNQEM
MKDHLPPPQNDVLILMCGPPPMIQYACIPNLDKLGYTKDMRFSF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttcttgttgcacagttgggttctgctttttggataaccatcgcccctaatgag
cccggctgctggctgtcaccggcctggacgagctggagggactcagggccctcagcagtg
ccggggcagggccctgggccccactcgttgggtcgctttgtgacatacccaatatggcta
atctacaccaccatcctgaggaggcttttcgggagtcacaatcatgcaattactctggag
gatcctgaagtgaagtatgcattgaggctgattgataaggaggaagttagtcatgataca
agaagatttcgatttgctctcccttctagagaccatattctgggtctccctgtaggacag
catatctacctgtctgcacggattgatggagctctggttgttagaccttacactccggtt
tctagttacgatgacaaaggctttgtggatcttgttgtcaaggtctacttcagaggtgtc
catccaaagtttcctgatggagggaagatgtcccagtacatagacggcctgaaaataggg
gatactattgacttcagaggaccaagtggcctacttgtctacaaaggaaaaggaacgttt
gctattcggcctgaaaagaaagctgaaccagttattaagaaagtgaaatatgtggggatg
attgcaggtgggactgggataacacctatgctgcagatcattcgagcaatcataaaagac
aaacacgaccctaccatttgtcagctgctctttgctaatcagacagagaaagatatcctg
ttacgttccgagctagaggagatccaggttcagaatcccggtcgcttgaagtgctggtac
acgctggacagagcacctgagaattgggagtacagccaaggatttgtgaaccaagagatg
atgaaagaccacctgcccccacctcaaaatgatgttctgatcctcatgtgtggacctcct
cccatgatccaatatgcttgcattcctaacttggacaaactgggctacaccaaggacatg
aggttctctttctaa

DBGET integrated database retrieval system